SecReT6
Protein ID: 556572238
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5372
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2298400..2299533 [+]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDU5V0W4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.30E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 8.30E-21, Aligned region: 140..154
ImpA-rel_N [PF06812], Evalue: 8.30E-21, Aligned region: 204..220
Protein Sequence: 377 a.a.     [Download]
>gi|556572238|ref|YP_008741824.1| LOW QUALITY PROTEIN: impA-related N-terminal family protein [Burkholderia pseudomallei NCTC 13179]
MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIR
RNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAG
FGDALAGLAAIDAWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAH
AHAHAHAHAHASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAE
HFVGKRYADVVQAIPAELLALWSADET
 
Nucleotide Sequence: 1134 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2298400-2299533 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGACCCCCAGCAGAAAACCGGCCGGCAGGGCGGCTGCCGCGCGCACGCCGAAGCCCGACGGCTGGATGG
CGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCGCGGC
GAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCGC
GCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGCTCGC
CGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGATCCGG
CGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTGACCC
GCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGCGGGC
TTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGACGCCTGGAGCGGCGAGCATCTCGGCGATTATGCGC
CGGACCTGTCGGCGCTCGATGCGCTGCTTCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCGCGGA
GGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGCGCACGCGCAC
GCGCACGCACACGCACACGCACACGCACACGCATCGCCGCCGCGGCGGCGCGAGCCCGCGGCGCAGGCAC
TCGCGGCTGCCATTGCGGGCGAACCGGCCGCGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCG
GCAGGCGCGCCAGTGGTTCGAGCAGCACGAGCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAG
CATTTCGTCGGCAAGCGCTATGCGGATGTGGTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCG
CGGACGAAACCTGA