SecReT6
Protein ID: 556572305
SecReT6 ID865
T6SS typei3
Gene symbolhcp1
Locus tagBBK_5235
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2129660..2130142 [+]
Productprotein hcp1
NoteTssD
UniProt IDU5V1N2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 6.90E-41, Aligned region: 6..136
Protein Sequence: 160 a.a.     [Download]
>gi|556572305|ref|YP_008741687.1| protein hcp1 [Burkholderia pseudomallei NCTC 13179]
MSHDIFLKINGIDGEAEDATHKGEIEVLSWSWNVSQQSNMHLGSGGGAGKATIDDLQFEHYIDRASPNLV
QYCLLGKHIDEARLVVRKAGGSPLEYIKLTMSDVLVTQVSPAGVAQDESRPRELVRLSFSRLKQEYVVQN
PQGGSGGAITATFDIKKNAA
 
Nucleotide Sequence: 483 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2129660-2130142 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGTCGCACGACATTTTCCTCAAGATCAACGGTATCGATGGCGAGGCGGAAGACGCAACCCACAAGGGCG
AAATCGAGGTCTTGAGCTGGTCGTGGAACGTCAGTCAGCAATCGAACATGCACCTGGGTTCGGGGGGCGG
CGCGGGCAAGGCGACGATCGATGATCTGCAGTTCGAACATTACATCGATCGCGCGAGCCCGAATCTCGTT
CAATACTGCTTGCTCGGCAAGCATATCGACGAAGCCCGGCTCGTGGTGCGTAAGGCGGGCGGCAGCCCGC
TCGAATACATCAAGCTCACGATGAGCGATGTGCTCGTTACGCAGGTGAGCCCGGCAGGCGTGGCTCAGGA
CGAATCGCGCCCGCGTGAGCTCGTTCGGCTGTCGTTCTCGCGCCTGAAGCAAGAGTATGTCGTCCAGAAC
CCGCAGGGCGGCAGCGGCGGCGCAATCACCGCGACTTTCGACATCAAGAAGAACGCGGCGTAA