SecReT6
Protein ID: 556572343
SecReT6 ID864
T6SS typei3
Gene symbol-
Locus tagBBK_4858
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1672290..1674494 [-]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDU5V163
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 7.20E-86, Aligned region: 23..325
Phage_GPD [PF05954], Evalue: 7.20E-86, Aligned region: 581..641
Phage_base_V [PF04717], Evalue: 1.00E-25, Aligned region: 364..456
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 510..525
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 516..539
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 530..547
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 556..579
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 581..603
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 646..664
Gp5_C [PF06715], Evalue: 1.30E-08, Aligned region: 715..727
Protein Sequence: 734 a.a.     [Download]
>gi|556572343|ref|YP_008741310.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MTRVFTLDSLHGDDLKFHRLYGEEALGRMFDFRIEALADNHSLSLKELLGKPVTVRIRQQDESERHLNGI
VARAALVGRRSERHYGYQLIVRPWLWLATRRSDCRIFQNKTVPEIVQDVLGTYGFPIENHLTDTYAPRDY
CVQYNETDAAFVSRLMEFEGIYYYFKHAAQTHTLMLCDAMASHVALPGYEHIPFIARDRTAIADEEHIDS
WLPAQEVSIGKHETSDYDYTKPRADLSAQKIDPRGHDHDGFASFEWPGGYRDDEPGAHYSRVRLEEQQAE
HERALARTDVRGIAPGYLFTLEHCPRADQNREYLIVRCQYRFQENAYATDSGNEAVVHESQTLVQPSSLP
YRSPRATPRPRTNGPQTATVVGPKGEEIWTDQYGRVKLQFRWDRYGQSDQNSSCWVRVSSPWAGGGFGGV
QIPRIGDEVVVDFLNGDPDQPIVTGRVYNGEKMPPWGLPGSATQSGLLSRSSPGGTAEHSNAFRFEDKKG
AEQLWMHAERNFDAETEQDHTLSVGHDHSHSVGNNEMMSVANDRQRSVGQNETVNIGKHRVAQIGGNETH
GVAGNRTRQVGQNEAVTIGANREATIGGNHVETVAKDKTETIGQGKTLNVTQHYQTTSKSMKTAVAEHHA
EEIGSRTSTIEKAHELNVGGSQSVNVGASHTMSVKNNVHVGAGDQISLVCGDASITLKKDGTIAINGVTV
ESSASGSHSVRGKTVTSSATGEHTVEGTILKLNP
 
Nucleotide Sequence: 2205 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c1674494-1672290 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGACCCGCGTGTTCACACTCGACAGCCTGCACGGCGACGACCTGAAGTTCCACCGGCTCTACGGCGAGG
AAGCGCTCGGGCGGATGTTCGACTTCCGGATCGAAGCGCTCGCCGACAATCACAGCCTGTCGCTGAAGGA
ACTGCTCGGCAAGCCGGTGACGGTGCGCATCCGGCAGCAGGACGAATCGGAGCGCCATCTGAACGGGATC
GTCGCGCGCGCCGCGCTGGTCGGGCGGCGCTCGGAGCGGCATTACGGCTATCAACTGATCGTGCGGCCGT
GGCTGTGGCTCGCGACGCGCCGCTCCGATTGCCGGATCTTCCAGAACAAGACGGTGCCGGAAATCGTGCA
GGACGTGCTCGGCACGTACGGCTTTCCGATCGAAAACCATCTGACCGACACGTACGCGCCGCGCGACTAC
TGCGTGCAGTACAACGAGACCGACGCGGCGTTCGTGTCGCGGCTGATGGAGTTCGAAGGGATCTACTACT
ACTTCAAGCACGCCGCGCAAACGCACACGCTGATGCTGTGCGACGCGATGGCGTCGCACGTCGCGCTGCC
GGGCTACGAGCACATTCCGTTCATCGCGCGCGACCGCACCGCGATCGCCGACGAAGAGCACATCGACAGC
TGGCTGCCCGCGCAGGAAGTGAGCATCGGCAAGCACGAGACGAGCGACTACGACTACACGAAGCCGCGCG
CGGATCTGTCCGCGCAGAAGATCGATCCGCGCGGCCACGACCATGACGGCTTCGCGTCGTTCGAATGGCC
CGGCGGCTATCGCGACGATGAACCGGGCGCGCATTACAGCCGCGTGCGGCTCGAAGAGCAGCAGGCGGAG
CACGAACGCGCGCTCGCGCGCACCGACGTGCGCGGCATCGCACCCGGCTATCTGTTCACGCTCGAACACT
GCCCGCGCGCCGACCAGAACCGCGAATACCTGATCGTGCGTTGCCAGTATCGGTTTCAGGAGAACGCGTA
CGCGACCGATAGCGGCAACGAGGCGGTCGTGCACGAATCTCAGACACTCGTGCAGCCTTCGAGCCTGCCG
TATCGCTCGCCGCGCGCGACGCCGCGGCCGCGCACGAACGGCCCGCAGACGGCGACCGTCGTCGGCCCGA
AGGGCGAGGAAATCTGGACGGACCAGTACGGGCGCGTGAAGCTGCAATTTCGCTGGGACCGCTACGGGCA
GAGCGACCAGAACTCGTCGTGCTGGGTGCGCGTGTCGAGCCCGTGGGCGGGCGGCGGCTTCGGCGGCGTG
CAGATCCCGCGCATCGGCGATGAGGTGGTGGTCGATTTCCTGAACGGCGACCCCGATCAGCCGATCGTGA
CGGGGCGCGTGTACAACGGCGAGAAGATGCCGCCATGGGGGCTGCCCGGCAGCGCGACACAAAGCGGGCT
GCTGTCGCGCTCGTCGCCGGGCGGCACGGCCGAGCATTCGAACGCGTTTCGCTTCGAGGACAAGAAGGGC
GCGGAGCAGCTGTGGATGCATGCGGAGCGCAACTTCGACGCGGAGACTGAGCAGGACCACACGCTGTCGG
TGGGCCACGATCATTCGCATTCGGTCGGCAACAACGAGATGATGAGCGTCGCGAACGACCGGCAAAGGAG
CGTCGGGCAGAACGAGACGGTGAACATCGGGAAACATCGCGTCGCGCAGATCGGCGGGAACGAGACGCAT
GGCGTCGCGGGAAACCGCACGCGGCAGGTCGGACAGAACGAAGCCGTGACGATCGGCGCGAATCGCGAGG
CGACGATCGGCGGCAATCACGTGGAGACGGTCGCGAAAGACAAGACCGAAACGATTGGGCAGGGCAAGAC
GCTGAATGTCACTCAGCACTATCAGACGACTTCGAAAAGCATGAAGACCGCTGTCGCCGAACATCACGCC
GAGGAGATCGGCTCGCGAACGTCGACGATCGAGAAAGCGCACGAGCTCAACGTTGGCGGTTCTCAATCGG
TGAACGTTGGCGCGAGCCACACGATGAGCGTGAAGAACAACGTACATGTCGGCGCGGGCGATCAGATCTC
GCTCGTTTGCGGCGATGCGAGCATCACGCTGAAGAAGGACGGCACGATCGCGATCAACGGCGTCACGGTG
GAATCGAGCGCCAGCGGAAGCCATAGCGTGCGCGGCAAGACAGTGACGTCGTCGGCGACGGGCGAGCACA
CGGTGGAAGGCACGATACTGAAACTGAACCCCTGA