SecReT6
Protein ID: 556572476
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5241
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2138245..2140959 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDU5V540
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.60E-78, Aligned region: 41..368
Phage_base_V [PF04717], Evalue: 8.40E-25, Aligned region: 408..501
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 552..572
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 585..601
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 593..614
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 613..630
Gp5_C [PF06715], Evalue: 0.0036, Aligned region: 618..637
Protein Sequence: 904 a.a.     [Download]
>gi|556572476|ref|YP_008741693.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MPNHFSNGRTNQSRTVVIRSGAMPRLLGQPALEFLSLRGEEHLGKLYTYELLLRTPDDFHVPLATSANLD
LKAMIGTEMTVCIQLDGIGTGVQGGVGAGAREISGLVVKAGFLRCEGRYNVYRIELRPWLWLATLTSDYK
IFQDKSVVEIIDTVLHDYPYPVEKRLDIDKYSVAGESARNEPRAFQVQYGETDFDFVQRLMEEWGIYWFF
EHSDNKHRLVLCDHIGGHRKAPSEAYHEIAHHPEGGKIDIEYINYFSTDEALRPGRVVIDDFDFTRPLAS
LVTSNHQPRETNWGEGELFEWPGDYTDSKHGDLISRVRMEERRATGSRAYGRGNVRGLACGHTFVLSKHK
HDGANREYLVIESALMLTEVADETGSGYRYECDNELVVQPSNEVFRMPRETPKPTTSGPQSAIVVGPPGH
EVWTDEFGRVKIRFLWDRYARNDATDSCWVRVSQAWAGVNFGGIYIPRIGQEVIVGFMNGDPDRPLILGS
LYNTITPPPWDLPGDATKSGFKSKSITGGRENYNGIRFEDKLGAEEFHMQAEKDMNRLTKNDESHTVGAN
FSIGVGLTHTRAVGAMFSSIVGGAASYAVGGAESTMIGGAYALNVGGAHAVAVGGASSVSVGGAYARNVG
GAYALTVGGVLSIVCGASSITMTACGSIKIVGKNIRIIGSDEVVVQGAPLQLNPGDSDCGGGGGGGGGGG
AIPPIPLPSFFLDITKPILPPPPPPPTEVPPDPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPT
PTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTPTSSEI
 
Nucleotide Sequence: 2715 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2138245-2140959 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCCAAACCATTTTTCGAACGGACGGACGAATCAAAGCCGCACGGTAGTGATCCGCAGCGGTGCGATGC
CGCGGCTGCTCGGTCAGCCCGCGCTCGAGTTCCTGTCGCTGCGCGGTGAAGAGCACCTCGGAAAACTCTA
CACGTACGAATTGCTCCTGCGCACGCCGGACGATTTTCATGTGCCGTTGGCAACGAGCGCGAATCTCGAC
CTGAAGGCGATGATCGGCACGGAGATGACGGTCTGCATTCAGCTCGACGGAATCGGGACGGGCGTGCAAG
GCGGCGTTGGCGCGGGTGCGCGCGAAATCAGCGGGCTCGTGGTCAAGGCGGGCTTCCTGCGCTGCGAGGG
GCGCTACAACGTCTATCGCATCGAGCTGCGCCCCTGGCTGTGGCTCGCGACTTTGACGAGCGACTACAAG
ATTTTTCAGGACAAGAGCGTCGTCGAAATCATCGATACGGTCTTGCACGATTACCCTTACCCGGTCGAGA
AGCGGCTCGACATCGACAAGTATTCGGTGGCGGGCGAGAGCGCTCGAAACGAGCCGCGCGCGTTCCAGGT
GCAATATGGCGAAACCGATTTCGACTTCGTTCAGCGTTTGATGGAGGAGTGGGGGATCTACTGGTTCTTC
GAGCATTCGGACAACAAGCATCGCCTGGTCTTGTGCGATCACATCGGCGGGCATCGCAAGGCGCCGAGCG
AGGCCTATCACGAGATCGCGCATCACCCGGAAGGTGGGAAGATCGACATCGAGTACATCAACTATTTCTC
GACGGACGAAGCGCTGCGGCCCGGCCGCGTCGTGATAGACGATTTCGACTTCACGCGTCCGCTCGCGAGC
CTCGTCACGTCCAATCACCAGCCGCGGGAGACGAACTGGGGGGAGGGCGAGCTGTTCGAATGGCCGGGCG
ACTACACCGATAGCAAGCATGGCGATCTCATCAGCCGCGTGCGCATGGAAGAGCGCCGCGCGACCGGGTC
GCGCGCATACGGTCGGGGCAACGTGCGCGGCCTCGCCTGCGGTCATACGTTCGTGCTGTCGAAGCACAAG
CACGACGGCGCGAACCGCGAGTACCTCGTCATCGAATCGGCGTTGATGCTGACCGAAGTCGCGGACGAAA
CGGGCAGCGGCTACCGCTACGAATGCGATAACGAACTGGTCGTGCAGCCGTCGAACGAGGTGTTTCGAAT
GCCGCGCGAAACGCCCAAGCCGACGACGAGCGGGCCACAGTCCGCGATCGTGGTCGGGCCGCCGGGCCAC
GAGGTATGGACCGACGAATTCGGCCGCGTGAAGATCCGTTTTCTGTGGGATCGCTACGCACGCAATGACG
CAACGGATTCCTGCTGGGTACGCGTGAGCCAGGCGTGGGCCGGCGTGAACTTCGGCGGCATCTACATTCC
GCGGATCGGACAGGAAGTGATCGTCGGATTCATGAACGGCGATCCGGACCGTCCGCTGATTCTCGGCAGC
CTCTACAACACCATTACGCCGCCGCCTTGGGATCTGCCCGGCGACGCGACGAAGAGCGGATTCAAGAGCA
AGTCGATCACGGGCGGGCGCGAGAACTATAACGGCATCCGCTTCGAGGACAAGCTGGGGGCCGAGGAATT
TCACATGCAGGCGGAAAAGGACATGAACCGCCTGACGAAGAACGACGAGTCGCATACGGTCGGCGCGAAT
TTTTCGATCGGCGTCGGGCTTACCCATACGCGCGCGGTGGGCGCCATGTTCAGCAGCATCGTCGGCGGAG
CCGCCAGCTATGCGGTGGGGGGCGCGGAATCGACGATGATCGGCGGCGCGTATGCGTTGAACGTCGGCGG
CGCGCACGCGGTTGCGGTGGGCGGCGCGTCGTCCGTTTCCGTTGGCGGCGCCTACGCGCGCAACGTGGGC
GGCGCGTATGCGCTGACAGTCGGCGGCGTGCTGTCGATCGTCTGCGGTGCGTCTTCGATCACCATGACAG
CTTGCGGCTCGATCAAGATCGTCGGCAAGAATATTCGCATCATCGGCAGCGACGAAGTCGTCGTGCAAGG
CGCGCCCCTGCAGCTGAATCCGGGCGATTCGGATTGCGGCGGAGGGGGAGGCGGCGGCGGCGGCGGCGGC
GCGATTCCGCCGATTCCGTTGCCGTCGTTCTTCCTCGATATCACGAAGCCGATTCTTCCGCCGCCGCCGC
CGCCACCGACGGAGGTGCCACCGGATCCGACGCCAACGCCGACGCCGACGCCGACGCCGACGCCGACGCC
GACGCCGACGCCCACGCCGACGCCAACGCCCACGCCCACGCCAACGCCAACGCCCACGCCGACGCCGACG
CCCACGCCGACGCCCACGCCGACGCCAACGCCAACGCCAACGCCGACGCCGACGCCGACGCCAACGCCAA
CGCCAACGCCAACGCCAACGCCAACGCCGACGCCTACGCCGACGCCGACGCCGACGCCGACGCCGACGCC
GACGCCGACGCCAACGCCAACGCCAACGCCAACGCCAACGCCAACGCCGACGCCTACGCCTACGCCGACG
CCGACGCCAACGCCGACGCCAACGCCAACGCCGACGCCCACGCCGACGCCTACGCCGACGCCCACGCCGA
CGCCCACGCCGACGCCCACGCCGACGCCGACGCCGACGCCCACGCCGACGCCGACGCCGACGCCGACGCC
GACGCCCACGCCAACGCCAACGCCAACGCCAACGCCGACTAGTTCCGAGATTTAA