SecReT6
Protein ID: 556572484
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4111
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]802218..803744 [+]
Producthypothetical protein
NoteTssC
UniProt IDU5V1B2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.70E-187, Aligned region: 81..506
Protein Sequence: 508 a.a.     [Download]
>gi|556572484|ref|YP_008740565.1| hypothetical protein BBK_4111 [Burkholderia pseudomallei NCTC 13179]
MNRDTEQTTMEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPK
RPIETVSQATIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKAAL
FDDFEDSPDITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAG
PAFFGIDSFGKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEER
VDGGDAHFLWGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISER
REFELAEQGFIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKV
IQRENIGSWKERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHF
KYMGAFFTLSLVGKLEKR
 
Nucleotide Sequence: 1527 bp     [Download]
>gi|556571789|ref|NC_022658.1|:802218-803744 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAACCGCGACACGGAACAGACGACCATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGC
CGGACGCGACGCCGCCCGAGTCCCCCGCCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCG
CGACGAAGACGCATACCCGATCACGCGCCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAG
CGCCCGATCGAGACCGTGAGCCAGGCGACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCC
GGCAGATCGACGCGATCCTCCATGACCCGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTT
TCTCGTCGATCGAACGGATTTCCGCGAGAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAGCGGCGCTG
TTCGACGACTTCGAGGATTCGCCCGACATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGT
ACGGCCAATTCGGCGGCCAGCCGATCGGTGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGA
CGTCAAGCTGCTGCAGTACGTCGCGAGCACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGC
CCCGCGTTCTTCGGCATCGATTCGTTCGGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGG
GGCCGCAATACGCGAAATGGAATGCGTTTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCC
GCGCTTCTTGCTGCGGCTGCCTTACGGCGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGC
GTCGACGGCGGCGACGCGCATTTTCTGTGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGA
GCTTCGCCGACTATCGCTGGTGCGCGAACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCC
GCTCTACGCGTACGAATCGATGGGCGAGATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGC
CGCGAGTTCGAGCTCGCCGAACAGGGCTTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCT
TTTTCTCCGCGAATTCCACGCAGAAGCCGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCT
CAACTACCGGCTCAGCACGCAACTGCCGTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTG
ATCCAGCGGGAAAACATCGGCTCGTGGAAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCC
GCCAGTACGTCGTCGACATGGACAACCCGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCA
GATCGTCGTGTCGGACGTCGAGGGCGAACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTC
AAGTACATGGGCGCGTTCTTCACGCTGTCGCTCGTCGGCAAGCTCGAAAAGCGCTAG