SecReT6
Protein ID: 556572513
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5250
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2151657..2152463 [-]
ProductimpE family protein
NoteTagJ
UniProt IDU5V1K4
KEGG IDbpk:BBK_5250
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 2.30E-43, Aligned region: 139..259
Protein Sequence: 268 a.a.     [Download]
>gi|556572513|ref|YP_008741702.1| impE family protein [Burkholderia pseudomallei NCTC 13179]
MLRDALRAQSFEEIKARTAEAVRKRPSDTRERWLLFQLLCIDGAWERALKQLQTWAGLEPQGEARAQLHR
GLIRCEMFRADVFAGKRTPGFIDAQPAWVDTLLQANAKLGAGDVAAADTLREAAFHCAPVTRGESAEMGS
FAWLTDSDTRLGPIFEIAVAGGYRWIPFEQLKSITFTPAGTLTDLVWRPVTALTLDATVLRGYAPTRYSG
SENGATAIRLASETTWRDIGTTNVVALGQRTWTTDQGDWGMLQIGGCRFTGESDDAAS
 
Nucleotide Sequence: 807 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2152463-2151657 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCTGCGCGACGCGCTGCGCGCCCAGTCTTTCGAGGAAATCAAGGCGCGCACGGCCGAGGCGGTCAGAA
AGCGGCCATCCGACACGCGGGAACGCTGGCTACTGTTTCAGTTGCTTTGCATCGACGGCGCGTGGGAGCG
CGCGCTCAAACAGCTGCAAACCTGGGCCGGGCTCGAGCCGCAGGGCGAGGCGCGCGCGCAACTGCATCGC
GGCCTGATCCGATGCGAAATGTTCCGGGCCGACGTGTTTGCCGGCAAGCGAACGCCGGGGTTCATCGACG
CGCAGCCCGCCTGGGTCGACACGCTCCTCCAAGCCAATGCGAAGCTCGGCGCCGGCGACGTCGCGGCGGC
GGACACGCTGCGCGAGGCCGCGTTCCACTGCGCCCCTGTCACCCGCGGGGAAAGCGCCGAAATGGGAAGC
TTCGCATGGCTTACCGACAGCGACACCCGCCTCGGTCCGATCTTCGAAATAGCGGTTGCAGGCGGCTATC
GATGGATTCCGTTCGAACAACTGAAGTCCATCACGTTTACGCCCGCCGGCACGCTGACCGACCTGGTCTG
GCGGCCGGTCACGGCACTCACGCTCGATGCCACGGTTCTCCGCGGCTATGCGCCCACCCGCTATTCGGGA
TCGGAGAACGGCGCGACCGCGATCCGCTTGGCCAGCGAGACGACTTGGCGCGACATCGGCACCACCAATG
TCGTGGCGCTCGGACAACGAACATGGACCACCGATCAGGGCGACTGGGGCATGCTCCAGATCGGCGGATG
CCGCTTCACGGGCGAAAGCGACGATGCGGCATCCTGA