SecReT6
Protein ID: 556572573
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5365
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2289061..2289642 [-]
Producthypothetical protein
NoteTssB
UniProt IDU5V1R1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.90E-59, Aligned region: 11..164
Protein Sequence: 193 a.a.     [Download]
>gi|556572573|ref|YP_008741817.1| hypothetical protein BBK_5365 [Burkholderia pseudomallei NCTC 13179]
MSASSSSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKPVAPLPAVADRRFLDIDIDNF
DERMKAIKPRVAFAVDNTLSGDGQLMVDMTFESIEDFSPAAIARMVGPLRQLLEARTQLANLQTYMDGKS
GAETLVNQLLQDPALLRSLAAAPKPQLAGGPDAGNARGAKDAPDTANHDSDAA
 
Nucleotide Sequence: 582 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2289642-2289061 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGTCCGCATCCAGCAGCTCTCAAAAATTCATCGCGCGCAACCGCGCGCCCCGCGTGCAGATCGAATACG
ACGTCGAAGTCTACGGCTCGGAAAAGAAGGTCGAACTGCCGTTCGTGATGGGCGTGCTCGCCGACCTGTC
GGGCAAGCCGGTCGCGCCGCTGCCCGCCGTCGCCGACCGGCGCTTCCTCGACATCGACATCGACAACTTC
GACGAGCGGATGAAGGCGATCAAGCCGCGCGTGGCGTTCGCGGTGGACAACACGCTGTCGGGCGACGGGC
AGCTGATGGTCGACATGACGTTCGAAAGCATCGAGGACTTCTCGCCCGCCGCGATCGCGCGAATGGTCGG
CCCGTTGCGGCAATTGCTCGAGGCGCGCACGCAGCTCGCGAACCTGCAGACCTACATGGACGGCAAGTCG
GGCGCCGAGACGCTCGTCAACCAGTTGCTGCAGGACCCGGCGCTGCTGCGCTCGCTCGCGGCCGCGCCGA
AGCCGCAGCTCGCGGGCGGGCCGGACGCGGGCAATGCGCGCGGCGCGAAGGACGCGCCCGACACGGCGAA
CCACGACAGCGATGCGGCCTGA