SecReT6
Protein ID: 556572630
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5368
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2293865..2294830 [+]
ProductimpE family protein
NoteTagJ
UniProt IDU5V2H9
KEGG IDbpk:BBK_5368
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 5.90E-49, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|556572630|ref|YP_008741820.1| impE family protein [Burkholderia pseudomallei NCTC 13179]
MTTPAFPAPPGARTSARPHDTLLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGEHAVGQLQAYARF
AAQHVHIAHAYRDLIRAERFRARVMAGQARPGFVFDAPPWIDDLREALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFADLAGWRLARPGVPLDLVWAPCVLTLADGSV
AHGFMPARCPGSELADGSGAPGASAASHEADAHESAGREADALRLGSRTAWRGVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAALGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2293865-2294830 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCGCGCACGTCGGCCCGGCCGCACGATACGCTGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGGGGGAACACGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGTGCACATCGCGCACGCCTATCGCGACCTGATCCGCGCCGAGCGCTTTCGCGCCCGCG
TGATGGCGGGCCAGGCGAGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCGGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTGCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCCGCTCGATCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCGGCGCGTTGCCCGGGCTCCGAACTGGCCGACGGGAGCGGCGCGCCGGGCGCCT
CGGCGGCCTCGCACGAGGCCGATGCGCACGAGAGCGCCGGGCGCGAAGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGGCGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGCGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA