SecReT6
Protein ID: 556572640
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4123
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]819563..820960 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5V2I9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-98, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|556572640|ref|YP_008740577.1| hypothetical protein BBK_4123 [Burkholderia pseudomallei NCTC 13179]
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRS
YVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRYATLPSAEEVADL
HSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVG
ELSVFSERFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRS
AQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|556571789|ref|NC_022658.1|:819563-820960 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGC
GCCCGACGCGCTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTG
CATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGC
TCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCT
CGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGC
ATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCG
CCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCACTGCT
GTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGC
GAGCTGAGCGTGTTCTCCGAGCGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGA
AATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCG
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAATGCCGCAGCTCAC
CGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGT
CGCTGCGCTGGGCCGACGCGCCGGACGACCTGCACGCGGAACTCGTCGCGGTGAGGCACACGCAATGA