SecReT6
Protein ID: 556572679
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5246
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2147135..2148205 [-]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDU5V1T8
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 61..120
ImpA-rel_N [PF06812], Evalue: 8.80E-22, Aligned region: 184..193
Protein Sequence: 356 a.a.     [Download]
>gi|556572679|ref|YP_008741698.1| LOW QUALITY PROTEIN: impA-related N-terminal family protein [Burkholderia pseudomallei NCTC 13179]
MNATPPAAALRYADLLEPVSPDAPCGPDLEYDPAFVMLQSAIAPRKDAQYGEFVEAPQPANWAEAERDCL
ALLLRTKDIRLVVILMRCRIRQSGAEGLRDGLALLNELLARYGEALHPVPFFEGERDPVVYANAIATLAD
PDATLADIREIPLPKASGLQLQLRDIEKALAVTRVKDALAPESASRLLKEWWNRRDKTIAALAQAQRIVA
DLIASTRESLGDDAPDLSGIAKLLHPFAQAQLESPYSANAAQPQGDAKPATGDAAHARAADTSAQAGNTD
TQAPAAMPIAPAQPPMDRWGALAAIQATRLWFEQNEPSSPVIVLLRQSERMVGKRFSEIANAIPAELLAQ
WDAIDV
 
Nucleotide Sequence: 1071 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2148205-2147135 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAATGCCACCCCACCCGCCGCCGCGCTGCGCTATGCGGATCTTCTCGAGCCCGTCTCGCCGGACGCAC
CCTGCGGGCCGGACCTCGAATACGATCCGGCGTTCGTGATGCTGCAATCCGCGATCGCGCCGAGGAAAGA
TGCGCAATATGGCGAGTTCGTCGAAGCGCCTCAGCCCGCGAACTGGGCCGAGGCCGAACGCGATTGCCTC
GCGCTGCTGCTGCGCACGAAAGACATTCGGCTCGTCGTGATCCTGATGCGATGCCGAATCCGCCAGAGCG
GCGCGGAGGGCCTGCGCGACGGCCTCGCGCTGCTCAACGAGTTGCTCGCACGCTACGGTGAGGCACTGCA
CCCCGTACCGTTCTTCGAAGGCGAACGCGATCCCGTGGTCTATGCGAATGCGATCGCCACGCTGGCGGAC
CCCGATGCGACGCTCGCGGATATTCGGGAAATCCCGTTGCCCAAGGCGAGCGGCCTGCAATTGCAGTTGC
GCGACATCGAAAAGGCGCTCGCGGTGACGCGCGTGAAAGACGCACTCGCGCCCGAATCGGCCAGCCGGCT
GCTGAAGGAATGGTGGAATCGGCGCGACAAGACGATCGCGGCGCTCGCGCAAGCCCAGCGCATCGTGGCC
GATCTGATCGCGTCGACCCGCGAGTCGCTCGGCGACGACGCGCCCGACCTGTCCGGCATCGCGAAACTGC
TGCATCCGTTTGCGCAAGCGCAACTGGAATCGCCGTATTCGGCAAACGCCGCTCAACCGCAAGGCGACGC
GAAGCCGGCGACCGGCGACGCCGCGCATGCGCGCGCCGCCGATACGTCCGCCCAGGCAGGCAATACCGAC
ACGCAAGCGCCCGCTGCGATGCCGATCGCGCCTGCCCAACCGCCGATGGATCGCTGGGGCGCGCTGGCGG
CCATTCAGGCAACGCGCCTTTGGTTCGAGCAGAACGAGCCGAGCAGCCCGGTGATCGTGCTGCTGCGCCA
GTCGGAGCGGATGGTCGGCAAGCGCTTTTCAGAAATCGCCAATGCGATTCCCGCCGAACTGCTCGCGCAA
TGGGATGCGATCGACGTCTAG