SecReT6
Protein ID: 556572794
SecReT6 ID863
T6SS typei1
Gene symbolclpV
Locus tagBBK_4116
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]807703..810750 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDU5V288
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 8.50E-41, Aligned region: 226..244
AAA_2 [PF07724], Evalue: 8.50E-41, Aligned region: 685..852
AAA [PF00004], Evalue: 1.20E-19, Aligned region: 227..336
AAA [PF00004], Evalue: 1.20E-19, Aligned region: 691..808
ClpB_D2-small [PF10431], Evalue: 5.00E-14, Aligned region: 857..929
AAA_5 [PF07728], Evalue: 2.60E-13, Aligned region: 227..245
AAA_5 [PF07728], Evalue: 2.60E-13, Aligned region: 690..804
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 224..310
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 409..439
AAA_22 [PF13401], Evalue: 9.70E-10, Aligned region: 689..784
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 37..117
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 202..247
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 269..307
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 351..464
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 430..497
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 541..609
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 661..726
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 755..784
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 846..891
AAA_16 [PF13191], Evalue: 2.60E-09, Aligned region: 920..973
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 225..245
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 305..353
Zeta_toxin [PF06414], Evalue: 5.50E-06, Aligned region: 684..731
Clp_N [PF02861], Evalue: 1.20E-05, Aligned region: 28..75
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 225..302
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 461..499
AAA_25 [PF13481], Evalue: 1.60E-05, Aligned region: 686..711
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 116..131
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 220..247
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 435..467
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 490..519
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 590..605
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 688..722
AAA_19 [PF13245], Evalue: 3.40E-05, Aligned region: 891..915
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 221..239
Sigma54_activat [PF00158], Evalue: 0.00012, Aligned region: 689..806
IstB_IS21 [PF01695], Evalue: 0.0002, Aligned region: 219..253
IstB_IS21 [PF01695], Evalue: 0.0002, Aligned region: 690..725
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 203..239
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 276..374
Arch_ATPase [PF01637], Evalue: 0.00021, Aligned region: 689..705
TIP49 [PF06068], Evalue: 0.00053, Aligned region: 226..251
TIP49 [PF06068], Evalue: 0.00053, Aligned region: 273..305
TIP49 [PF06068], Evalue: 0.00053, Aligned region: 690..726
NACHT [PF05729], Evalue: 0.0018, Aligned region: 227..253
NACHT [PF05729], Evalue: 0.0018, Aligned region: 690..711
AAA_17 [PF13207], Evalue: 0.0019, Aligned region: 227..249
AAA_17 [PF13207], Evalue: 0.0019, Aligned region: 690..725
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 113..155
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 223..245
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 288..313
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 399..488
AAA_10 [PF12846], Evalue: 0.0031, Aligned region: 690..837
ResIII [PF04851], Evalue: 0.0038, Aligned region: 210..246
ResIII [PF04851], Evalue: 0.0038, Aligned region: 292..307
ResIII [PF04851], Evalue: 0.0038, Aligned region: 661..716
Torsin [PF06309], Evalue: 0.0062, Aligned region: 648..715
AAA_14 [PF13173], Evalue: 0.0079, Aligned region: 278..328
AAA_14 [PF13173], Evalue: 0.0079, Aligned region: 689..772
AAA_18 [PF13238], Evalue: 0.0089, Aligned region: 228..245
AAA_18 [PF13238], Evalue: 0.0089, Aligned region: 691..732
Protein Sequence: 1015 a.a.     [Download]
>gi|556572794|ref|YP_008740570.1| type VI secretion ATPase, ClpV1 family [Burkholderia pseudomallei NCTC 13179]
MLLVDLKPLIEQLNPYCRNALESAVGACVARRHDDVAVEHLLARLCDEPSADVALLLRACGADAARLRRQ
ADAALDARPAGDGGRPAFAPSLLALLQDAWLIASLELGDTHIRSAAVLAAAVARAARQPSPSGDDVLQSL
RKDALVARFASGACARSIESRASGALDAAPDEASDTRDASSAIARYCEDFTAKARAGGIDPVFGRDAEIR
QIVDILARRRKNNPVCVGEPGVGKTAVVEGLALRIAEGDVPATLRGATLLGLDLGMLQAGASVKGEFEQR
LKRVIAEIRASQTPVVLFIDEAHTLIGAGGAAGASDAANLLKPALARGELRTIAATTWSEYKKYFEKDAA
LARRFQPVKLDSPDVATSVMILRGLKERYQDAHGVTIRDDALVAAAELSARYITGRQLPDKAIDLLDTAC
ARVKVRQQTKPAALEDAQRAIQALERERRALRDELAERCAPDTPRVADIDRELAALSARAGALRDAWAAQ
REAAQALVDARRACRAAADATDAAGTTGTAHAGELADSADVSDVADVAKMADAADAAPADAETGSNARDA
DARMPAGTCARIAPNPDARARPPLRAPHADARERAARALAEATRRFEHAQRDTPLVRIDVDPDAIADVVA
DWTGIAAGKLRRDRANVMLRLADTLRRRIRGQDHAIEQISEAVKAGAAGVHDPRRPLGVFLLAGPSGTGK
TETALAVADALFGDERSIVAVNMSEFQERHDVSRLIGSPPGYVGYGEGGMLTEAVRQRPYSVVLLDEVEK
AHPDVLNLFYQVFDKGSLSDGEGKEVDFANTVIFLTSNLGADIIADIAACGARPDPDAMRAAVRPALSRH
FKPALLARMTEIPYAPLAPDTLADIARLKLERIAARVAAQHATRIVYDDAVVAHVAARCTEVESGARNVD
FILQRHVLPALAQHVLVCAGNAAPMPAIRVAIDAGGRFVVSNDAPTNSDAWDRSEASDASDASDAIDAVD
AVDAVDAPNAPNAPNAPNAPNAPNAPNAPNAPNAR
 
Nucleotide Sequence: 3048 bp     [Download]
>gi|556571789|ref|NC_022658.1|:807703-810750 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCTGCTGGTTGACCTGAAACCGTTGATCGAACAGCTCAACCCCTATTGCCGGAACGCGCTCGAAAGCG
CCGTCGGCGCGTGCGTCGCGCGCCGGCACGACGACGTCGCCGTCGAGCACCTGCTCGCGCGGCTGTGCGA
CGAGCCGTCGGCCGACGTCGCGCTGTTGCTGCGCGCGTGCGGCGCGGACGCGGCGCGCCTGCGCCGGCAG
GCCGACGCCGCGCTCGACGCGCGCCCGGCGGGCGACGGCGGCCGCCCCGCGTTCGCGCCGTCGCTGCTCG
CGCTGTTGCAGGACGCGTGGCTGATCGCGTCGCTCGAGCTCGGCGACACGCACATCCGCTCGGCGGCCGT
GCTCGCCGCCGCGGTCGCCCGCGCGGCGCGGCAGCCGTCGCCCAGCGGCGACGACGTGCTGCAGTCGCTG
CGCAAGGACGCGCTCGTCGCGCGCTTTGCGAGCGGCGCGTGCGCTCGATCGATCGAATCGCGCGCGTCCG
GCGCGCTCGACGCCGCGCCGGACGAGGCGAGCGACACGCGCGACGCATCGAGCGCGATCGCCCGCTACTG
CGAGGACTTCACCGCGAAAGCGCGCGCCGGCGGGATCGATCCGGTCTTCGGTCGCGACGCGGAAATCCGC
CAGATCGTCGACATCCTCGCGCGGCGGCGCAAGAACAATCCGGTGTGCGTCGGCGAGCCGGGCGTGGGCA
AGACGGCCGTCGTCGAAGGGCTCGCGCTGCGGATCGCCGAAGGCGACGTGCCGGCGACGCTGCGCGGCGC
GACGCTGCTCGGCCTCGACCTCGGCATGCTGCAGGCGGGCGCGAGCGTGAAGGGCGAATTCGAGCAGCGG
CTCAAGCGCGTGATCGCCGAGATCCGCGCGTCGCAAACGCCCGTCGTGCTGTTCATCGACGAAGCGCACA
CGCTGATCGGCGCGGGCGGCGCGGCGGGCGCGTCCGACGCGGCGAACCTGCTGAAGCCCGCGCTCGCGCG
CGGCGAGCTGCGCACGATCGCGGCCACCACGTGGAGCGAATACAAGAAGTATTTCGAGAAGGACGCGGCG
CTCGCGCGGCGCTTCCAGCCGGTGAAGCTCGACAGCCCGGACGTCGCGACGTCGGTGATGATCCTGCGCG
GGCTGAAGGAGCGCTATCAGGACGCGCACGGCGTGACGATCCGCGACGACGCGCTCGTGGCCGCGGCCGA
GCTGTCGGCGCGCTACATCACCGGCCGGCAGTTGCCGGACAAGGCGATCGACCTGCTCGACACCGCGTGC
GCGCGCGTGAAGGTGCGCCAGCAGACCAAGCCCGCCGCGCTGGAGGACGCGCAGCGCGCGATCCAGGCGC
TCGAGCGCGAGCGGCGCGCGCTGCGCGACGAATTGGCCGAGCGCTGCGCGCCGGATACGCCGCGCGTCGC
CGACATCGATCGCGAGCTCGCCGCGCTGTCCGCGCGCGCCGGCGCGCTGCGCGACGCGTGGGCGGCGCAG
CGCGAAGCCGCGCAGGCGCTCGTCGACGCACGCCGCGCGTGCCGGGCGGCGGCGGATGCAACGGATGCGG
CTGGAACGACCGGAACGGCCCATGCCGGCGAGCTCGCCGATAGTGCCGACGTTTCCGATGTCGCCGATGT
CGCCAAGATGGCCGATGCGGCCGACGCCGCCCCTGCCGATGCCGAAACCGGCTCGAACGCCCGCGACGCC
GACGCACGCATGCCCGCCGGGACGTGCGCGCGCATCGCCCCGAACCCGGATGCGCGGGCGCGGCCCCCTC
TGCGCGCGCCGCACGCCGACGCGCGCGAGCGCGCGGCTCGTGCGCTCGCCGAAGCGACGCGCCGCTTCGA
GCACGCGCAGCGCGACACGCCGCTCGTGCGAATCGACGTCGATCCGGACGCGATCGCCGACGTCGTGGCC
GACTGGACCGGCATCGCGGCCGGCAAGCTGCGCCGCGATCGCGCGAACGTGATGCTGCGGCTCGCCGATA
CGCTGCGCCGCCGCATCCGCGGCCAGGATCACGCGATCGAACAGATCTCCGAAGCCGTGAAGGCGGGCGC
GGCCGGCGTCCACGATCCGCGCCGCCCGCTCGGCGTGTTCCTGCTCGCGGGGCCGTCGGGCACCGGCAAG
ACCGAGACCGCGCTCGCGGTCGCCGATGCGCTGTTCGGCGACGAGCGCTCGATCGTCGCCGTCAACATGA
GCGAATTCCAGGAGCGGCACGACGTGAGCCGCCTGATCGGCTCGCCGCCGGGCTACGTCGGCTACGGCGA
GGGCGGGATGCTGACCGAGGCGGTGCGCCAGCGGCCCTATTCGGTCGTGCTGCTAGACGAAGTCGAGAAG
GCGCACCCCGACGTGCTGAACCTGTTCTACCAGGTGTTCGACAAGGGTTCGCTGTCCGACGGCGAAGGCA
AGGAGGTCGACTTCGCGAACACGGTGATCTTCCTCACGTCGAATCTCGGCGCGGACATCATCGCCGACAT
CGCCGCGTGCGGCGCGCGGCCCGATCCGGACGCGATGCGCGCGGCGGTGCGCCCGGCGCTGTCGCGCCAT
TTCAAGCCGGCGCTGCTCGCGCGGATGACCGAGATTCCGTATGCGCCGCTCGCGCCCGATACGCTCGCCG
ACATCGCGCGGCTGAAGCTCGAGCGCATCGCGGCGCGCGTCGCCGCGCAGCACGCGACGCGCATCGTCTA
CGACGACGCCGTCGTCGCGCACGTCGCCGCGCGCTGCACCGAAGTCGAATCGGGCGCGCGCAACGTCGAT
TTCATCCTGCAGCGCCACGTGCTGCCCGCGCTCGCGCAGCACGTGCTCGTGTGCGCGGGCAACGCGGCGC
CGATGCCTGCGATTCGCGTCGCCATCGACGCCGGCGGCCGCTTCGTCGTCTCGAACGACGCGCCGACCAA
CTCCGATGCATGGGACCGGAGCGAAGCGTCCGATGCGTCCGATGCGTCTGATGCGATCGACGCGGTCGAC
GCGGTCGATGCGGTCGATGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCAACGCACCCA
ACGCACCCAACGCACCCAACGCACCCAACGCACGCTGA