SecReT6
Protein ID: 556572899
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5370
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2295429..2297318 [+]
Producthypothetical protein
NoteTssF
UniProt IDU5V2I2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-214, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|556572899|ref|YP_008741822.1| hypothetical protein BBK_5370 [Burkholderia pseudomallei NCTC 13179]
MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPNYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFEL
LHVAGVATLTAAPGEFAAPGCPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALSVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2295429-2297318 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGGACCCGCAATTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCG
CGCGCGCGCACCCGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGC
TTCACCGGCCGCCTGCTCGAGGTGCTCTATCCGAACTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGC
GCCTGTACCCGAGCCGCACCGAAGGCAATCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGC
CGCGCGCGTGCCGGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCGGCGCGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACATGCGCATCGCCGATCT
GCGGGGCCTCGACAGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCTGCCCGCCCG
CGGCGGTTACCGTCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTG
GGCGAAGTTCCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAAC
AATCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTCCGCGCCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGG
CCGAACTCGAGTTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGC
ACGGAGATGTTCGTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGG
TGGACGCGCTGGTGACGAACCGCGACTTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGC
GATCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCG
GCGGCAGGTGGAAAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAACGGGCTTCTCCGGCGTGAGCCCGT
ATCTGTTCGGGCTCGTGCTCGAGCATTATCTGGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGCCGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA