SecReT6
Protein ID: 556572936
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4114
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]804964..806706 [+]
Producthypothetical protein
NoteTssF
UniProt IDU5V6F7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.90E-160, Aligned region: 7..580
Protein Sequence: 580 a.a.     [Download]
>gi|556572936|ref|YP_008740568.1| hypothetical protein BBK_4114 [Burkholderia pseudomallei NCTC 13179]
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDEGLPELV
QALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCR
FVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCA
LGARALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPD
WLPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHY
VPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTIGHLALNFLSLGDADHLKRMLALHAFGERGDDARAQAD
RRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEID
ASPDGVRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|556571789|ref|NC_022658.1|:804964-806706 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGCCACCACCACGCCCAATCGCTATTACGAGGACGAGCTCGTTCGCCTGCGCGAGCTCGCCGCCGAGT
TCGCCCGCGCGCACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAACGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAAAAGCTCGACGAAGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGCTGTTTCCGCACTCGCTGCGCCCGGTGCCGGCGGCCACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCGGTGATCGCGGCCGGCACCGAGATCGAATCGGTGCCCGTCGA
CGGCACCGCCTGCCGGTTTCGCACGTGCGGCGAGCTCGACATCGAGCCGATCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGCACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGCCTCGACGCGAGCG
AATGGGACGCGACGCGCATTCGCCTGTTCATCGGCGGCGAGCGGCTGCACGCAAGCCGCCTGTTCGCGCT
GCTGATGCAGCACGTCGTAGCGGTCGAGATCGCGGGCGGCCCGCCCGAGCTGCCCGGCCCGCGCTGCGCG
CTCGGCGCCCGCGCGCTGCGCCCGGCGGGCTTCGACGACGCGCTGCTGCCCTGCCCCGAGCGGGCGTTCC
CCGGCTTCCGGCTGCTGCACGAATATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGGGCGGCCT
CGAGCGCTGGCGCGCGGCGCGCGCGGGCGCGCAGTTCAGCGTATGGCTCGCGCTCGACAGCGCGCCCGAC
TGGCTGCCCGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCGCCGCGCTGAACCTGTTCGCGCACG
AAGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGATTACCGGCTGCAGCCCGAAGGCGACACGTCGGG
CCACTACCGGATCTACTCGGTCGACCGCGTGATCGGCTACCGCCCCGGCCACGCGGTCGACCGCCATTAC
GTGCCGTTCGGCGTCGCGGGCGACGACGCGAACGCCGCGAGCTACCGGCTGATTCGCCGCGCCGCGCTCG
ACGGCCATGGGCAGGATCTCCATCTGGCGCTCGCCTACCCGCCCGGCGAGGCGCTCGCCACGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCGCGTTGCCCGCGCGCCTGAAGATCGGCGACGTGTGCCGCGCG
ACCGACAGCTCGCCCGAGCGCTTCACGTTCGCCAACATCGCGCCCGTGAGCCCGCCGCTCGATCCGCCGC
TCGGCGAACCGCTGCTGTGGCGCACCATCGGCCATCTCGCGCTGAACTTCCTGTCGCTCGGCGACGCCGA
CCATCTGAAGCGCATGCTCGCGCTCCACGCGTTCGGCGAACGCGGCGACGACGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGGGCCGAGACGCGGATCATCGGCGAGCGGATGC
TGAGCGGCCAGCGCGTGGCGCTGCGCTGCAGCGCCCATGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGATCAACACCTACACGCGCGTCGAGATCGAC
GCGTCGCCCGACGGCGTGCGCTTCGCGTGGCCGCCGCGAATGGGGGCGCAATGCCTGCTCTAG