SecReT6
Protein ID: 556573145
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5247
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2148224..2149273 [-]
Producthypothetical protein
NoteTssG
UniProt IDU5V3Y9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-98, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|556573145|ref|YP_008741699.1| hypothetical protein BBK_5247 [Burkholderia pseudomallei NCTC 13179]
MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDTRMPLPGTACLPKEEAFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRAEHETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPIAVDEYVFHWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2149273-2148224 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGACGGCGCATCCGCCCGCCGCCCGGCCCATCGACGCCCACTCGCCCCTGCATCCGGACGCACTGCGGG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCGGGCTTTCTGAGCCTGTTGCGCGCAATCGCCGCACGCGA
CACGCGCATGCCCTTGCCCGGAACGGCGTGTCTGCCGAAGGAAGAGGCGTTTCGCATCGGACAACGGCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGCCTCGGCCTATGGGGGCCGCAGGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTACAACCGCGC
CGAGAGCTATCAGGATCATGCGATCGCGCATTTCTCCAATCTCTTTCACCATCGTGCGCTCGCGTTGTTC
TATCGTGCGTGGGCGTCGTCACAGGCGACCGTATCGCTCGATCGCGCCGAGCACGAAACGTTCTCGTTCT
ATATCGGCAGCCTGATGGGCACCGATCCCGAAGAAGCCGCGCGCACGCACCCGCCCACGCACGCGCGGTA
CGCCGCATGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCCACGCTGTCGCATTAC
TTCGGCGTGCCGATCGCCGTCGACGAATACGTCTTCCACTGGATCCGGATTGCGCCGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCATCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTGCCGATTG
CCAGCACAAGTTCCGGCTCGTCATCGGCCCGCTCGATCTCGACCAATATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCGACCCTGGTCGATTGGGTGCGCGCCTTCGTCGGTCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCGCGCGCCGCGCCGCCCGCCCGCGCGGATACCACGCACCGCCTCGGCTATTCGACCTG
GCTCGGCGAATCGAGGGACGACAGGCCGGTCGTCGGCATGGTGTTCGAGCCGGAAAAATACTGTTCCTGA