SecReT6
Protein ID: 556573183
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5725
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2745046..2746908 [+]
Producthypothetical protein
NoteTssF
UniProt IDU5V3G0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-127, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|556573183|ref|YP_008742170.1| hypothetical protein BBK_5725 [Burkholderia pseudomallei NCTC 13179]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPGRKLPVMFSTAREVTLLPLRL
ASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIAELAREDDGFKPLHLSVAGDLPRAYALHRAL
LADTTAWYALVSTNRGDEVLPLPMSGIRLSGVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFDLFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVATRDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2745046-2746908 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAACTTCCTCGATCACTACAACGACGAATTGCGCCAGTTGCGCGATGCGGGCGCACGCTTCTCCAAGG
AGCACCCGCAGGTGGCCTCCGCGCTCGGGCTGCATCCGGATGCGGTCACCGATCCGTTCGTCGAGCGCCT
GCTCGAGGGCGTCGCGTACCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACACGGCTTCGACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCCGATCTCGGCTCGCCCGATGCGTTTCGCGGCAATACGCTGCCGCGCGGCTCGCTCATCGCCGCGCA
CCTGCCCGGGCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGAGGTCACGCTGCTGCCGCTGCGTCTC
GCATCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCGCGCAGCGGCTCGCCTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGATCGAGGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
CGGCTTCAAGCCGCTGCATCTGAGCGTGGCGGGCGATCTGCCGCGCGCATATGCGCTGCACCGCGCGCTG
CTTGCCGACACCACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGTGACGAGGTGCTGCCGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGACGAGGAGGCGCTGCTGCCCGAGGCGTTCGGCGGGCTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCCACGCGGCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCGAAGGCGCCGTCCGCGCGCGCGTTCGATCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTGGGCGACGTCGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGACCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTCACCGAGGTGTTCGTGTGCGAGACCAACGGTCGCGCGCACCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTACGAAGGGCACGAAGGCTCGATCCGCTATGGCATGCGGCGCGA
GGACGCGCTGCTCGTCGACGGCGTGCGGCGCGACCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGAGCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGCCCGAGCGCTCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACCGCGGTCAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCGGTC
TCGCACGTCGGGCGCAACCCGCTCGCGCTGCGCGCGTCGCAGCAGCAGGACGTGACGGCGCGCATCGTCG
AGCAGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGATCGCCAGCGGCTCGAGAGCCTGCGCTCGGT
CGTGCTGCGCTCGCGCTTCGTCGCGGCGGGGCGCGCCACGCCCACCGCGCTGGTGCGCGCGACACAGGTG
GAGATCGACATCGCCGAATCGCTGCACGCCGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCGGAGGCCGCCACGCTCAACGACGGCATCGAGATCGTGGTGCGCCTGGACGGCGAAGCGGCGAG
CACGCACACGAACGTCGCCACGCGCGACGGGAGGCTCGCATGA