SecReT6
Protein ID: 556573238
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5360
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2283592..2284857 [-]
Producttype VI secretion system OmpA/MotB family protein
NoteTssL
UniProt IDU5V3S3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 46..256
OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 315..413
Protein Sequence: 421 a.a.     [Download]
>gi|556573238|ref|YP_008741812.1| type VI secretion system OmpA/MotB family protein [Burkholderia pseudomallei NCTC 13179]
MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPERLDRDD
IPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFH
EDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPV
SVALSPHWQPGPRSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPA
ELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAKVPGKVTVRGY
TDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2284857-2283592 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGACGTTCGCGCGGCGCG
AGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAGGCTCGCCCGCAACCC
GCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGGCTCGATCGCGACGAC
ATTCCGCAATTGCGCCTGCTGCTGGAACAGGAGGTGCGCCTGTTCCAGCGGCTCTGCGAACAGGCGAACA
TCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGCGATGCAGAC
GTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACGTCGTTCCAC
GAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATTCCCCGCACGAGCACA
TCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTACCGTTACGAAGCCGA
CGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCGCAGCGCGGGCCGGTG
TCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAGCAGGAGCGCGCCGTTTCGCGATTTCCCCG
CGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTTCAAGTACGCGCTGTC
GACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCGCCCGCCGCGCCGGCC
GAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCGGGCACGCTCAGCGTCGAGGAAAACGCGC
GCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGGCGTGAACCCGGCGAT
GGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAAGGTGCCGGGCAAGGTGACGGTGCGCGGCTAC
ACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCGAAGAGCGCGCGACGC
AGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAAGGGCGGCGC
CGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATCACGGTCGCG
CGCTGA