SecReT6
Protein ID: 556573343
SecReT6 ID864
T6SS typei3
Gene symbol-
Locus tagBBK_4860
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1677136..1678590 [-]
Producthypothetical protein
NoteTssG
UniProt IDU5V419
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 9.20E-126, Aligned region: 85..431
Protein Sequence: 484 a.a.     [Download]
>gi|556573343|ref|YP_008741312.1| hypothetical protein BBK_4860 [Burkholderia pseudomallei NCTC 13179]
MTTNPKPEPAGVDAGSHANSNAGRRAGAAANAEANAEPDAMPNALRGAAADVAPSAAPSATPNATPSATS
QAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYASRPRDEPVRFGQAPSLAFAAAMLADVR
DDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAAFADLFHHRLILLFYRAWADAQPTVSL
DRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLPDSPPDSPPDSRSDSPSDARLDPHPDS
PRGAGALAPHAKYHQAGHLVRHTRNPEGLVQILRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRPTQPL
GGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFLPGGVHARQLAQWVREYVGIEFDWDVQLELARGEVPTLG
HGLGRTAWLGERLDPGPARDLVLGYDERMRASRARSGAADQAAAAGALIANLPEREPPCPISAE
 
Nucleotide Sequence: 1455 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c1678590-1677136 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGACGACGAACCCGAAACCGGAGCCCGCCGGCGTGGACGCGGGTTCGCACGCGAACTCGAATGCGGGCC
GGCGCGCCGGTGCGGCCGCGAATGCGGAGGCGAACGCGGAGCCGGACGCGATGCCGAATGCGCTCCGGGG
CGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCAAATGCAACGCCGAGCGCGACGTCG
CAGGCCGCCGCCGCGCGCCGCGACGCGTGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTACGACCTGT
TTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCGCGGCCGCG
CGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCGACGTGCGT
GACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCCGCTGCCGT
CGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCGTTCGCCGA
CCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCGTCAGCCTC
GATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGCGTTGCTTG
CCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCTGATTCACC
GCCTGATTCGCCGCCTGATTCGCGGTCCGATTCCCCGTCCGATGCGCGCCTCGATCCGCATCCCGACTCG
CCGCGCGGCGCTGGCGCGCTCGCGCCGCACGCGAAGTATCACCAGGCCGGCCATCTGGTGCGGCACACGC
GCAACCCGGAGGGGCTCGTGCAGATCCTGCGGCGCTACTTCGGTGTGCGGGTACGCATCGTCGAGCACGT
GCCGCACTGGGTGATGCTCGATCGCGCGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACGCAGCCGCTC
GGCGGCGCCGTGCTCGGCCGTGCGGTGCGCGACGCGCAGTCGCGCTTCCGGATCGTGCTCGGCCCGCTGA
CGCTCGACGAATACCGGCGGTTCCTGCCGGGCGGCGTCCATGCGCGGCAGCTCGCGCAATGGGTGCGCGA
ATACGTCGGCATCGAATTCGACTGGGACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTGCCGACGCTCGGT
CACGGGCTCGGCCGCACCGCATGGCTCGGCGAGCGGCTCGACCCCGGCCCCGCGCGCGACCTCGTGCTCG
GCTACGACGAGCGCATGCGCGCTTCGCGCGCACGATCGGGCGCGGCCGATCAGGCGGCCGCCGCCGGTGC
ATTGATCGCCAACCTGCCTGAACGGGAACCGCCATGTCCGATATCGGCCGAGTGA