SecReT6
Protein ID: 556573463
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5722
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2742339..2743850 [+]
Producthypothetical protein
NoteTssC
UniProt IDU5V4C7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.80E-183, Aligned region: 69..495
Protein Sequence: 503 a.a.     [Download]
>gi|556573463|ref|YP_008742167.1| hypothetical protein BBK_5722 [Burkholderia pseudomallei NCTC 13179]
MSMQQLESSAEKVVVDQNNVNEDLKDILRRSFRPRTNEAAEAVQNAVETLLTYARRSRVVVREDVAQTIE
QLVAELDKKISEQLTLVLHNKRFQSLEGAWRGLHYLVSNTDTSENLKIRYLNISKADLGKTLRRFKGVVW
DQSPIFKMIYEQEYGQFGGEPFGCLIGDFYFDHSMQDVSILTEMSKISAAAHAPFIAAAAPGLLQMDDWS
ELSNPRDVSKIFTATEYAFWRRLRESNDSRYLALTLPRFLARVPYGPKTQPVEEFGFEEKVDPNRAEDFC
WANSAYAMGANITRAFKTYGWCTKIRGVESGGAVEVLPKFVLPSQDREVDLHCPTEIAISDRREHELSES
GLMPLVYRKNSDTAAFIGAKTVHRPAIYEDDDATANSNLSSRLPYIFATCRFAHYLKCIVRDKIGSFKSA
EDTQRWLNDWLMNYVDGDPSISSEVTKSQRPLSAAEVVVDEIPENPGYYRAQFFLRPHFQLEGLTVSLRL
VSKLPSTKHEVTT
 
Nucleotide Sequence: 1512 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2742339-2743850 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGTATGCAGCAGCTTGAATCGTCTGCCGAGAAGGTGGTCGTCGATCAGAACAACGTCAACGAGGATC
TGAAGGACATCCTGCGCCGCTCGTTCCGGCCGCGCACCAACGAGGCGGCCGAGGCGGTGCAGAACGCGGT
CGAGACGCTGCTCACGTATGCGCGGCGCAGCCGGGTCGTGGTTCGTGAGGATGTCGCGCAGACGATCGAG
CAGCTGGTTGCCGAGCTCGACAAGAAGATCTCCGAGCAACTGACGCTCGTGCTGCACAACAAGCGCTTTC
AGAGCCTCGAAGGCGCGTGGCGCGGATTGCACTACCTCGTGTCGAACACCGATACGAGCGAGAACCTGAA
GATCCGCTACCTGAACATCTCGAAAGCGGATCTCGGCAAGACGCTGCGGCGCTTCAAGGGCGTCGTGTGG
GATCAGAGTCCGATTTTCAAGATGATCTACGAGCAGGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTGATCGGTGACTTCTATTTCGACCACAGCATGCAGGACGTGTCGATCCTCACCGAGATGTCGAAGAT
CTCGGCGGCCGCTCACGCGCCGTTCATCGCGGCCGCCGCGCCCGGCCTGCTGCAGATGGACGACTGGAGC
GAGCTGTCGAACCCGCGCGACGTGTCGAAGATCTTCACGGCGACCGAGTATGCGTTCTGGCGGCGCCTGC
GCGAGAGCAACGACTCGCGCTACCTCGCGCTCACGCTGCCGCGCTTCCTCGCGCGTGTGCCGTATGGTCC
GAAGACGCAGCCCGTCGAAGAGTTCGGCTTCGAGGAGAAGGTCGATCCGAACCGTGCGGAGGATTTCTGC
TGGGCGAACTCCGCGTATGCGATGGGCGCGAACATCACGCGCGCGTTCAAGACCTACGGCTGGTGCACGA
AGATTCGCGGCGTCGAGTCGGGCGGCGCGGTCGAGGTGCTGCCGAAGTTCGTGCTGCCGTCGCAGGATCG
CGAAGTCGATCTGCATTGCCCGACCGAGATCGCGATCTCGGACCGCCGCGAGCACGAATTGTCCGAGTCG
GGCCTGATGCCGCTCGTGTATCGGAAGAATTCGGATACGGCCGCGTTCATCGGCGCGAAGACCGTGCATC
GTCCGGCGATCTACGAGGACGACGACGCGACCGCGAACTCGAACCTGTCGTCGCGGCTGCCGTACATCTT
CGCGACCTGCCGTTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGTCGGCC
GAGGACACGCAGCGCTGGCTCAACGACTGGCTGATGAACTACGTGGACGGCGACCCGAGCATCTCGAGCG
AGGTGACGAAGTCGCAGCGTCCGCTGTCGGCGGCGGAGGTGGTCGTCGACGAGATTCCGGAAAACCCCGG
CTACTATCGCGCGCAGTTCTTCCTGCGCCCCCATTTCCAACTGGAGGGTTTGACCGTTTCTCTCCGGCTG
GTTTCGAAGCTTCCGTCGACCAAGCACGAGGTGACGACCTGA