SecReT6
Protein ID: 556573500
SecReT6 ID866
T6SS typei3
Gene symbol-
Locus tagBBK_5374
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2300662..2301933 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDU5V4Y2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_base_V [PF04717], Evalue: 3.40E-22, Aligned region: 48..140
Protein Sequence: 423 a.a.     [Download]
>gi|556573500|ref|YP_008741826.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MIGATFEATETGGASGPGAYRIDTSFVAQPATTAFRPPRTVRKPRTRGPQTAIVTGPRGQDIWTDQYGRV
KLKFHWDRSLVDDQNSSCWVRVSYAWSGNNYGGVNIPRVGSEVVVDFEHGDPDRPLVTGQVYNALHMPPW
PLPENATQSGFMTRSPAGGGENANMLRFEDKAGEEQVKLHAERNYDVSVERDATTAVGRKHLTLVGVDLM
PVMSTRSPLERLIDLLRTGGAASPAASGQPAAASRQPSGQQQQHQQQHQQHQRQRQPYQQLKQQRQMQRA
GGWQALAANVAKTLQEIVAVLTDPFVTASVSTVQGASTSVVFGDAKGVHVGDTVKITSGDAHSEVNGTAS
SKDVNSVSLKGTSTSLTGVSTSETGTNIVTTGLTVSTTGASVSTTGFSATETLVQVAKKTQECEFIKGIK
ISM
 
Nucleotide Sequence: 1272 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2300662-2301933 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
GTGATCGGCGCGACGTTCGAGGCGACGGAGACGGGCGGCGCGTCGGGGCCGGGCGCATATCGGATCGACA
CGTCGTTCGTCGCGCAGCCGGCGACCACCGCGTTCCGGCCGCCGCGCACGGTGCGCAAGCCGCGCACGCG
CGGGCCGCAGACGGCGATCGTCACCGGCCCGCGAGGGCAGGACATCTGGACGGACCAGTACGGCCGTGTG
AAGCTGAAATTCCACTGGGACCGTTCGCTCGTCGACGATCAGAACTCGTCGTGCTGGGTGCGCGTTTCCT
ATGCGTGGTCGGGCAACAATTACGGCGGCGTCAATATTCCGCGCGTGGGCTCCGAAGTGGTCGTCGATTT
CGAGCACGGCGACCCGGACCGGCCGCTCGTGACGGGGCAGGTATACAACGCGCTGCACATGCCGCCGTGG
CCGTTGCCGGAGAACGCGACGCAAAGCGGCTTCATGACGCGCTCGCCCGCGGGCGGCGGCGAGAACGCGA
ACATGCTGCGCTTCGAGGACAAGGCGGGCGAGGAGCAGGTCAAGCTGCATGCGGAACGCAATTACGACGT
ATCGGTCGAGCGCGACGCGACGACTGCCGTCGGGCGCAAGCACCTGACGCTCGTCGGCGTCGACCTGATG
CCGGTGATGTCGACGCGCTCGCCGCTGGAGCGGCTGATCGACCTGCTGCGCACGGGCGGCGCGGCCAGCC
CGGCGGCGTCGGGGCAGCCGGCGGCGGCTTCCCGGCAACCGTCGGGACAGCAGCAGCAACATCAACAGCA
ACACCAGCAACATCAGCGGCAACGCCAGCCCTATCAGCAGTTGAAGCAGCAGCGCCAGATGCAGCGCGCG
GGCGGATGGCAGGCGCTCGCGGCGAACGTCGCGAAGACGTTGCAGGAAATCGTGGCGGTGCTCACGGACC
CGTTCGTCACCGCGTCGGTGAGCACCGTGCAGGGCGCGTCGACGTCCGTCGTGTTCGGCGACGCGAAGGG
CGTGCACGTGGGCGATACCGTCAAGATCACCAGCGGAGACGCGCATTCGGAGGTCAACGGCACGGCATCG
TCGAAGGACGTGAACAGTGTCTCGCTGAAGGGCACGTCGACCAGCCTGACCGGGGTGAGCACCTCCGAAA
CGGGGACGAACATCGTGACGACCGGACTCACGGTATCAACGACCGGCGCGAGCGTTTCGACGACCGGATT
CAGTGCGACCGAAACGCTCGTGCAGGTCGCCAAGAAGACGCAGGAATGCGAATTCATCAAGGGCATCAAG
ATCTCGATGTGA