SecReT6
Protein ID: 556573565
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4107
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]797072..798898 [-]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDU5V543
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 69..128
ImpA-rel_N [PF06812], Evalue: 2.70E-18, Aligned region: 568..578
Protein Sequence: 608 a.a.     [Download]
>gi|556573565|ref|YP_008740561.1| LOW QUALITY PROTEIN: impA-related N-terminal family protein [Burkholderia pseudomallei NCTC 13179]
MGMSERHPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDW
RAATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQ
WLVDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEV
ADEADVAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAAPSAGTDTNANADAARQPAR
LDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVCALPETDAENGRTRIAAPSASIV
GAAKNIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGADARREVETAVRALLARLPGLDA
LTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPERSSPMAGEPARAPGDACGASADDA
VDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHEVPEAFARGVIEPIRRHDLL
AWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST
 
Nucleotide Sequence: 1827 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c798898-797072 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGGGATGAGCGAACGGCACCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTAGAAG
CGCTCGCCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGC
GAGGTTCGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGG
CGCGCGGCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATC
TGGCGGGTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCT
CGTCGAACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAA
TGGCTGGTCGATCGCGTCGACGCCATGCATGATGCAGGGGCCGCCGCATGCGGCGGCGCGTGCTCGGCCG
AACTGGTCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGC
GCCGACGATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTG
GCTGACGAGGCTGATGTGGCTGAGACGGCCGAGACGGCTGAGACGGCTGAGACGGCTGAGGCCGATGCGC
ACGGCTCGACGGGAGGGCCGGCCGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCGGC
CGGTCGAGCCGCGCCGAGCGCAGGCACGGATACGAACGCGAACGCAGACGCCGCCAGGCAACCGGCGCGG
CTCGACGAAGCGGCCGGCCGCGAACGCGCGCTCGCCGATGCGCTCGCGCAATTGCATTGCGTCGCGACGG
CGTTCGCGCAAGCGGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGT
GTGCGCGCTGCCGGAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTC
GGCGCGGCGAAGAACATCGACGGGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGC
AGGCGTTCCCGCTCTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGGGGCGACGG
CGCCGATGCGCGGCGCGAAGTGGAGACGGCGGTTCGTGCGCTGCTTGCGCGGCTGCCGGGCCTCGACGCG
CTGACGTTCGCGGACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGC
CTGTTGTGGCGGCGGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCG
ATCGTCGCCGATGGCGGGCGAGCCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGTGCCGACGATGCA
GTGGACCGAGCGTGCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGA
TCGATCGTGCGACGAGCGCCGAACAGCGGTTGAGAGCGCGCGTGCGGTTGTGCGAGCTTGCGCGCGACCA
TTGGCCGCATGAGGTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGACTTGCTC
GCATGGAATCCGGAGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCG
AATCGGCGCACGCGAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTC
GACGTGA