SecReT6
Protein ID: 556573574
SecReT6 ID864
T6SS typei3
Gene symbol-
Locus tagBBK_4875
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1696615..1698051 [+]
ProductFHA domain protein
NoteFha
UniProt IDU5V4D0
KEGG IDbpk:BBK_4875
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-10, Aligned region: 29..96
Protein Sequence: 478 a.a.     [Download]
>gi|556573574|ref|YP_008741327.1| FHA domain protein [Burkholderia pseudomallei NCTC 13179]
MQLTVIEHAGEPVGTDGRNAVVLHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATGAAAAAPAASAAQAQAKGAGNK
LWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREG
EGRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATP
ETLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPL
KLLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAAPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|556571789|ref|NC_022658.1|:1696615-1698051 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGCTTC
ATGCGCCGGGCGGCACGATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAGAT
TTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCGC
CACGGGGGCCGCGGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCAACAAA
CTGTGGGGCCTGTTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGC
GCGCCGCGCCGGCGCGCCACCACGATTCGCCGGCGTCCGCCGCGCCGCGCGACCTGAATCAGCTGTCGAC
CGATCCGCTCGACCTGTTCGCGCAGCCGCACGGCGATCCGGATGCGCGAGCCGGCGCCGCGCGCGAAGGC
GAAGGCCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAGTGGACGCAACACGTCCGCGTGC
AGCCGGCGCAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCC
CGCAGCGGGCGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCC
GAGACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCCGCCGAACAGCATCACTGGTCCG
CCGAGCAGTTGTTCGTCGCGGGGCAGCTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTC
ACGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTG
AAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACAC
CGCAAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCG
CGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCGCGCCCCAG
TGGTACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAACCACGCATCGCG
ACACGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGC
GGAAGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA