SecReT6
Protein ID: 556573601
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5730
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2753211..2755499 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDU5V8D4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|556573601|ref|YP_008742175.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSRDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2753211-2755499 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCACG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATCTGCTGAGCCGCGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCTGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATTTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAGCAGAGTCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGTCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTCGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGCGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATTTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACCGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA