SecReT6
Protein ID: 556573766
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5236
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2130339..2130812 [+]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDU5V8V0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 7.00E-37, Aligned region: 3..151
Protein Sequence: 157 a.a.     [Download]
>gi|556573766|ref|YP_008741688.1| type VI secretion lipofamily protein [Burkholderia pseudomallei NCTC 13179]
MVCASLAACASLPARKETADLIVKIKVSEGANPDEHQRPAPVMVRLYELKSAGAFENADFFTLQSDSRKV
LGDDAIATDEFVMRPGDTRDIHRRADSAGTSVGVLVGYRELGKSVWRAVHKLRPAPEDAWYRAFTPRTKI
KLNVDVGQQTVTITELE
 
Nucleotide Sequence: 474 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2130339-2130812 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGTATGCGCATCGCTCGCGGCTTGCGCAAGCTTGCCGGCACGCAAGGAAACAGCCGATCTGATCGTGA
AGATCAAGGTGAGCGAAGGCGCCAATCCGGATGAGCATCAGCGCCCGGCGCCCGTGATGGTGCGGCTGTA
CGAGTTGAAATCGGCCGGCGCGTTCGAGAACGCCGATTTTTTCACGCTACAGAGCGACAGCCGCAAGGTG
TTGGGTGACGACGCGATCGCGACGGATGAATTCGTGATGCGCCCGGGCGACACCCGGGATATTCATCGGC
GTGCCGATTCCGCGGGGACGTCGGTCGGCGTGCTGGTCGGTTATCGAGAGCTCGGCAAATCGGTGTGGCG
GGCGGTCCATAAGCTGCGGCCGGCTCCGGAAGATGCATGGTACCGGGCATTCACGCCAAGGACGAAAATC
AAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACGATTACAGAATTGGAATGA