SecReT6
Protein ID: 556573804
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4117
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]810777..813800 [+]
ProductRhs element Vgr family protein
NoteTssI
UniProt IDU5V534
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.00E-67, Aligned region: 46..349
Phage_base_V [PF04717], Evalue: 2.80E-16, Aligned region: 396..489
Protein Sequence: 1007 a.a.     [Download]
>gi|556573804|ref|YP_008740571.1| Rhs element Vgr family protein [Burkholderia pseudomallei NCTC 13179]
MPSSPRHDAPASRANAAPSANARRFTFASDAYDPATFDVVDINGRDAISQPYRFEITLVSRQSRIDFAKM
LSRGATLAILPPFGEAGTTRYAGVLAEFEQKKRFRDFTVYRATLVPRLWRLSLYKASDVYLNEQTIPDIV
KRVLRAASFGSRDFRMRHGGGYRKRSFVCQYDESHLDFVSRWMEKEGLYYYFEHDGRHETLVIVDDRRHQ
PGPADDLALRYLPATSLDAGIEADRVQAFTCRATPLPREVVLRDFNHRKAELSLEVRERVARDGVGERVS
SDEHFHTKDEGRRYAKLRAEALVCEGRRFAGESTAAGLRAGRFFALSGHYREDFDGRYLVTALTHRGSQA
HLLFPDLDAPFGATPGEPIYRAEFEAIAADLQYRPPRTTPKPRAAGVVSAIVDGEGGGKLAELDEYGQYK
VRFPFAHTAHPANKASARIRMATPYAGDDRGMHLPLLKRTEVKIAFDGGDPDRPVIVGAVPNSSHRSVVT
RRNPAEHRILTEHNQLYMKDGSGAATWLHAPNNHIGIGAVGPGDGLALLTSGNKFDFSLGNAYSFSGGLK
CSVSMGGNTDVYVGVRNSLDVSANFLTTLQGNLRWMLPGSRSFEINDSASTLLQTLHKQSATGAIRLSAG
QDASALLQKQLDKLKGTVRKFMIVSGLANAGSAAAAAGLIKGGGKLADLPWAGFGISAAQFAGATGVSTA
LMATSRTLLANVAKLQEALPLVADLSLGKQGIALAAKNLTHATRMSLTVDGVSWSTHAKGPGAAGAAMSV
GKGRWGVEAAKHAHVHASDTLLFAVPADPTTQFDLKDLIGLRRDLDECMKDIADLEADISENEVLSTDQN
TFGVSALIPTPPSPAGALAAVAIKVKQAKLVELKAKQKLVALKVDNLQQKFAKHVQHLSAVRMSTSDAQL
GFKGNRLVATADGVTLAHAQGKAKLDVREAKIGVTAGKSSVELDEGKIAAGCGSASLKLGSDGAIDVSAT
DVKLNGTNVKLNGSASLKFDGQLIQLG
 
Nucleotide Sequence: 3024 bp     [Download]
>gi|556571789|ref|NC_022658.1|:810777-813800 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCCTTCGTCCCCCCGCCACGATGCGCCCGCGTCGCGCGCGAACGCCGCGCCGTCCGCGAACGCGCGAC
GCTTCACGTTCGCGAGCGACGCGTACGACCCCGCGACGTTCGACGTCGTCGACATCAACGGCCGCGACGC
GATCTCGCAGCCGTACCGGTTCGAGATCACGCTCGTGAGCAGGCAGTCGCGGATCGACTTCGCGAAGATG
CTGAGCCGCGGGGCGACGCTCGCGATCCTGCCGCCGTTCGGCGAGGCCGGCACCACCCGCTATGCCGGCG
TGCTCGCCGAATTCGAGCAGAAGAAACGCTTTCGCGACTTCACCGTCTATCGCGCGACGCTCGTGCCGCG
CCTCTGGCGACTATCGCTGTACAAGGCGTCGGACGTCTATCTGAACGAGCAGACGATTCCCGACATCGTC
AAGCGCGTGCTGCGCGCCGCCTCGTTCGGCAGCCGCGATTTCCGCATGCGGCACGGCGGCGGCTACCGCA
AGCGCAGCTTCGTCTGCCAGTACGACGAGAGCCATCTCGATTTCGTGTCGCGCTGGATGGAGAAGGAAGG
CCTCTACTACTACTTCGAGCATGACGGCCGGCACGAAACGCTCGTGATCGTCGACGACCGCCGCCATCAG
CCCGGCCCCGCCGACGATCTCGCGCTGCGCTACCTACCCGCGACCAGCCTCGACGCGGGCATCGAAGCGG
ACCGCGTGCAAGCGTTCACATGCCGGGCGACGCCGCTGCCGCGCGAAGTCGTGCTGCGCGATTTCAACCA
CCGCAAGGCGGAGCTCTCGCTCGAAGTCCGCGAGCGCGTGGCGCGCGACGGCGTCGGCGAGCGGGTGTCG
AGCGACGAGCACTTCCACACGAAGGACGAAGGGCGGCGCTACGCGAAGCTGCGCGCCGAGGCGCTCGTCT
GCGAAGGGCGCCGATTCGCCGGCGAATCGACCGCGGCCGGGCTGCGCGCCGGCCGCTTCTTCGCGCTGTC
GGGCCACTACCGCGAGGATTTCGACGGCCGCTATCTGGTGACGGCGCTCACGCATCGCGGCTCGCAGGCA
CACCTGCTGTTTCCCGATCTCGACGCGCCGTTCGGCGCGACGCCGGGCGAGCCCATCTACCGCGCCGAGT
TCGAGGCGATTGCCGCCGACCTCCAGTACCGGCCGCCGCGCACGACGCCCAAGCCGCGCGCGGCGGGCGT
CGTCAGCGCGATCGTCGACGGCGAGGGCGGCGGCAAGCTCGCCGAGCTCGACGAATACGGCCAGTACAAG
GTGCGCTTTCCGTTCGCGCACACCGCGCATCCGGCGAACAAGGCCTCCGCGCGCATCCGGATGGCGACGC
CCTACGCGGGCGACGACCGCGGCATGCACCTGCCGCTGCTGAAGCGCACCGAAGTGAAGATCGCATTCGA
CGGCGGCGATCCGGACCGCCCCGTGATCGTCGGCGCGGTGCCCAACTCGTCGCACCGCAGCGTCGTCACG
CGCCGCAACCCCGCCGAGCATCGCATCCTCACCGAGCACAACCAGCTCTACATGAAGGACGGCAGCGGCG
CGGCGACGTGGCTGCACGCGCCGAACAACCACATCGGCATCGGCGCGGTCGGGCCGGGCGACGGCCTCGC
GCTCCTCACGTCCGGCAACAAGTTCGACTTCTCGCTCGGCAACGCGTACAGCTTCTCGGGCGGGCTCAAG
TGCTCGGTGTCGATGGGCGGCAACACCGACGTCTACGTCGGCGTGCGCAACAGCCTCGACGTCAGCGCGA
ACTTCCTGACGACGCTGCAGGGCAACCTGCGCTGGATGCTGCCCGGCAGCCGGAGCTTCGAGATCAACGA
CAGCGCATCGACACTGCTGCAGACGCTGCACAAGCAGTCCGCGACGGGCGCGATCCGGCTGTCCGCCGGG
CAGGACGCGTCCGCGCTGCTGCAAAAGCAGCTCGACAAGCTCAAGGGCACGGTGCGCAAGTTCATGATCG
TGTCGGGCCTCGCGAACGCCGGGTCCGCGGCCGCCGCCGCGGGGCTCATCAAGGGCGGCGGCAAGCTCGC
CGATCTGCCGTGGGCGGGCTTCGGCATATCCGCCGCGCAGTTCGCCGGCGCGACCGGCGTCAGCACGGCG
CTGATGGCGACCTCGCGCACGCTGCTCGCGAACGTCGCGAAGCTCCAGGAGGCGTTGCCGCTCGTCGCCG
ATCTGTCGCTCGGCAAGCAGGGCATCGCGCTCGCCGCGAAGAACCTCACGCACGCGACGCGGATGTCGCT
CACCGTCGACGGCGTCTCGTGGTCGACGCACGCGAAGGGGCCCGGCGCGGCGGGCGCCGCGATGAGCGTC
GGCAAGGGCCGCTGGGGCGTCGAAGCGGCGAAGCACGCGCACGTCCACGCGAGCGACACGCTGCTGTTCG
CGGTGCCGGCCGACCCGACGACCCAGTTCGACCTGAAGGACCTGATCGGGCTGCGCCGCGATCTCGACGA
ATGCATGAAGGACATCGCCGATCTCGAAGCCGACATTTCGGAAAACGAAGTGCTGTCGACCGATCAGAAC
ACGTTCGGCGTCAGCGCGCTCATCCCCACGCCGCCGTCGCCCGCCGGCGCGCTCGCGGCGGTCGCGATCA
AGGTGAAGCAAGCGAAGCTCGTCGAGCTGAAGGCCAAGCAGAAGCTCGTCGCGCTGAAGGTCGACAACCT
GCAGCAGAAGTTCGCGAAGCACGTGCAGCACCTGAGCGCCGTGCGGATGAGCACTTCCGACGCGCAGCTC
GGCTTCAAGGGCAACCGGCTCGTCGCGACGGCCGACGGCGTCACGCTCGCGCATGCGCAGGGCAAGGCGA
AGCTCGACGTGCGCGAAGCGAAGATCGGCGTCACGGCGGGCAAATCGAGCGTCGAGCTCGACGAAGGGAA
GATCGCGGCCGGCTGCGGCAGCGCATCGCTGAAGCTCGGCAGCGACGGCGCGATCGACGTGAGCGCGACC
GACGTCAAGCTGAACGGCACCAACGTCAAGCTGAACGGCAGCGCGTCGCTGAAGTTCGACGGCCAACTGA
TCCAGCTCGGCTGA