SecReT6
Protein ID: 556573887
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5237
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2130818..2132167 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5V9A4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.70E-143, Aligned region: 20..447
Protein Sequence: 449 a.a.     [Download]
>gi|556573887|ref|YP_008741689.1| hypothetical protein BBK_5237 [Burkholderia pseudomallei NCTC 13179]
MSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLSPFFWGFSRYEIDQESLSFGKLVFKSGAGIFP
DGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNTEETAFDEQAGSLARYSAFEIELRDSNAIGQG
PKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGSVALYDGDHIPPVSQYGANPLLREWATQLHGL
AKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEPLLEHICRIREMPPVTLYRELSMLAGELSTFV
RPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIRGAQPIPLTEQPHGIRVATMLPSELAGYSSLV
LAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGMTMIPLPVPPRQIPFNSSYIYYELSRTGPFWE
QIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1350 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2130818-2132167 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGCTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCTTCCCCAGCTGTTTCAACAACAGG
AACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGCCCGTTTTTCTGGGGATTCAGCCG
ATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCAAGAGCGGTGCGGGAATATTTCCC
GACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCCGCTGACGATTGCCGCCGAGCATC
AGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACAGAGGAGACCGCGTTCGACGAACA
AGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCGACAGCAATGCGATCGGTCAAGGG
CCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGAAAAGGAGCTGACGCAGTCCTGGA
TCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGTTCGGTCGCGCTGTACGACGGTGACCA
CATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAATGGGCGACCCAGTTGCACGGCCTC
GCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGATGGCCGGGCCGGGGCGGCGGCCG
AGGTAGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCGCTGCTCGAGCACATCTGCAGGAT
TCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGGCAGGCGAATTGTCGACGTTCGTG
CGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGCGCAGTTGTATGCGAGCATTCGCC
CGCTGGTCGACGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGAGGCGCGCAGCCGATCCCGCTCAC
CGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAACTCGCGGGCTATTCGAGCCTCGTG
CTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTTCGCATCCCAAACGAAGATCAGCC
ATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATGACGATGATTCCGTTGCCGGTGCC
TCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTATCCCGCACGGGGCCGTTCTGGGAA
CAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTTCCCTGAACTCAAGCTCGAACTTT
GGGGAGTGCGTCACAAATGA