SecReT6
Protein ID: 556573960
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5232
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2125334..2127010 [+]
ProductompA family protein
NoteTagL
UniProt IDU5V694
KEGG IDbpk:BBK_5232
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.90E-18, Aligned region: 441..537
DUF218 [PF02698], Evalue: 0.00057, Aligned region: 446..517
Protein Sequence: 558 a.a.     [Download]
>gi|556573960|ref|YP_008741684.1| ompA family protein [Burkholderia pseudomallei NCTC 13179]
MSRQIRFWLVWGAIPFVVLASLCLPLRMQPDWSHVLTIVLIIAAIVLAIEISEHSRETAQDRTAEAEIDD
HELAVIIVAGPHASSLFNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESD
DESDMRQAFAKWRTELREALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVG
ELLASIRQQLLRPSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLADVGRRPIRPGAW
TRWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFSTVSTLGIAVAV
SGWMNSRMIQRVSNDIADYRSGADEWIGRKRFVQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKL
DTVLDSPRAASIAMQLDTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQ
LSEARARAIRDWFVDQGVLKTRFIVQGAGDTHPIADNDSSSGRAQNRRVEVLLIPDVSSDRKASGTEL
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2125334-2127010 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGTCGCGTCAGATTCGATTTTGGCTCGTATGGGGCGCCATACCCTTCGTGGTGCTCGCGAGCCTTTGCC
TGCCGTTGCGCATGCAGCCGGATTGGTCTCATGTGCTGACCATCGTTCTGATCATTGCCGCCATCGTACT
GGCGATCGAAATATCCGAACACTCTCGCGAGACAGCGCAAGACCGAACGGCCGAAGCCGAAATCGACGAT
CACGAGCTGGCGGTGATCATCGTCGCGGGCCCCCACGCATCGTCGCTTTTCAATAGCAGCGGAGACGATA
CGGCGTTTCGGCGCGAAGCCGGCGCGTTATGGCTGCGCGCCGACAGCGTCGAGCAATTGCGAGACACGAT
GATGCGCGTCAAGGCATCGCGCGGACGGTTCCCGGACGCCGCCGTGGTGCCGCTCGTATCGGAAAGCGAT
GACGAAAGCGACATGAGGCAGGCGTTCGCGAAGTGGCGAACCGAACTCCGCGAAGCGCTTTGCTATCCCG
ATGCGGCCTATGTCCTGCCTTGCTATCTCGCCGTCTACACGTGTCTTGGATTCAAGGGAGCCGACGGCGC
GCGTCCGAAGTGGACGGGCGATGCAATAGAAATCGGCACGAGGCAGATGAATGCCGCATCGAAAGTGGGC
GAGCTGCTCGCATCGATTCGACAACAACTGCTTCGGCCGTCGCCCACCGGTTCGTCGGCGCAGTGCGCGC
TGGGGCTCGGCGTGTTCGATTGGCTCGACGCCACGGCGCTGCTGTCGTCGATGACCATGCTGGCGAATAC
CCCGCCATTCATGCTGAAAGGGCTGACGCTCGCGGATGTCGGCAGACGGCCGATACGTCCGGGAGCGTGG
ACGCGCTGGCTCACTGTTCGGACCGGTCTCCATATTCGCCAGACTAAATCGTCGATGGCGCCGCTTCCCG
TGCCGCGCGTGGCGAAGCATGCCGAAAGCGGCATTCGGGAAGGATGGAGCAGCGCGCGCCATCTCGTTTC
CACTCGCGCGAGCTTCGTGCCGGCGCTCGTGTTCTCCACTGTTTCGACGCTGGGCATCGCCGTGGCGGTC
TCGGGCTGGATGAACAGCCGCATGATCCAGCGGGTGTCGAACGATATCGCGGATTATCGGAGCGGAGCCG
ACGAGTGGATCGGGAGGAAGCGCTTTGTGCAGGCCCGCCTCGAACACGATCGCACGGCGATCGTGCAGAC
GCTGCTCGATGGCGTACCGACCGGTTTCGGCTGGGGACTCTACCGGGGGCAGGAGTTGCTGGTCAAGCTC
GATACGGTGCTGGATTCGCCGCGCGCGGCGTCGATCGCGATGCAGCTCGACACGGTATCGCTGTTCGCCG
CAGGCAAGGCTACATTTTCTCCGGGCGCCGCGCAGCGTGAGTTGCAACATGCATTGCGGATGATTCTCGC
CAATCCGGAGCAACGTGTGCTGATCGTCGGTCATGCAGACAGCTCCGGCTCGGATGCGGCCAATTTTCAG
TTATCCGAAGCGCGCGCGCGCGCGATTCGTGACTGGTTCGTCGATCAAGGCGTGCTGAAGACGCGCTTCA
TCGTGCAAGGAGCCGGCGATACGCATCCGATCGCCGATAACGACAGCTCTTCGGGACGTGCGCAGAATCG
CCGTGTCGAGGTCTTGCTGATTCCGGACGTTTCTTCCGACAGGAAGGCGAGCGGTACGGAACTATAG