SecReT6
Protein ID: 556574058
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5736
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2760535..2761896 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5V606
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 8.10E-120, Aligned region: 21..448
Protein Sequence: 453 a.a.     [Download]
>gi|556574058|ref|YP_008742181.1| hypothetical protein BBK_5736 [Burkholderia pseudomallei NCTC 13179]
MSSLPVGPVAWSDGMLIETQHFQQLERHLAHQASLRLGQTSNHGWGFTLLDLDQDGLGLGRLGLRHARGV
FQDGTAFSLPSDDPLPPPLETELAQAGDIACLALQAARTGGPEMAFGDVELASRYRAVSTEVPDLAVGLD
APGTPRRLTIETGQLVTRLCWKSQLRSDEVALPIARVAGRNASRTVSLDPRFIPPLLDTRAHLVLRSLID
ELQSTLRVRLASTSAQRVLSTGGGVADLIELLLRQAIAEYRMRLANLDAFDPLPPAMLYHELVGLLGRLS
VLPGVDEELADRELGYDHDDLQTSFEPLAMMLRQALARVIETPVLPLRFEDRGDQVHICIVDKQWNLKKL
IFAFSAAMPAEKLRQLLPQQTKLGAVEQIQKLVDLQLPGARLNALPNPPRQIPYYAQSTYFEVESTDPFW
KQTLAGSAMALRIVGDFPDLRFEAWGLRDGKVA
 
Nucleotide Sequence: 1362 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2760535-2761896 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGTAGTCTGCCGGTAGGACCGGTCGCGTGGAGCGACGGCATGCTGATCGAGACGCAGCACTTCCAGC
AGCTCGAGCGGCATCTCGCGCATCAGGCCTCGCTGCGGCTCGGTCAGACGTCGAATCACGGCTGGGGCTT
CACGCTGCTCGATCTCGACCAGGACGGCCTGGGGCTTGGCCGGCTCGGGCTGCGCCACGCGCGCGGCGTG
TTCCAGGACGGCACCGCGTTCTCGCTGCCGTCGGACGATCCGCTGCCGCCGCCGCTGGAAACCGAGCTCG
CGCAGGCGGGCGACATCGCGTGCCTCGCGCTGCAGGCCGCGCGCACGGGCGGCCCGGAGATGGCGTTCGG
CGACGTCGAGTTGGCGTCGCGCTATCGCGCGGTATCGACCGAGGTGCCGGATCTCGCGGTCGGGCTCGAC
GCGCCCGGCACGCCGCGGCGCCTGACGATCGAGACGGGCCAGCTCGTCACGCGCCTGTGCTGGAAGTCGC
AGCTGCGCTCGGACGAGGTCGCGCTGCCGATCGCGCGCGTGGCGGGGCGCAACGCGAGCCGCACGGTGTC
GCTGGATCCGCGCTTCATTCCGCCGCTGCTCGACACGCGCGCGCACCTGGTGCTGCGCTCGCTGATCGAC
GAGCTGCAGAGCACGCTGCGCGTGCGGCTCGCGAGCACGTCCGCGCAGCGCGTGCTGTCGACGGGCGGGG
GCGTGGCCGATCTGATCGAGCTGCTGCTGCGCCAGGCGATCGCCGAGTACCGGATGCGCTTGGCGAACCT
CGACGCGTTCGATCCGCTGCCGCCGGCGATGCTGTATCACGAGCTGGTCGGCCTGCTCGGGCGGCTGAGC
GTGCTGCCGGGCGTCGACGAGGAACTGGCCGACCGCGAGCTCGGCTACGACCACGACGATCTGCAGACGA
GCTTCGAGCCGCTCGCGATGATGCTGCGCCAGGCGCTCGCGCGCGTGATCGAGACACCGGTGCTGCCGCT
GCGCTTCGAGGATCGCGGCGATCAGGTGCACATCTGCATCGTCGACAAGCAGTGGAACCTGAAGAAACTG
ATTTTTGCGTTTTCGGCCGCGATGCCGGCGGAGAAGCTGCGGCAACTGTTGCCGCAGCAGACGAAGCTGG
GCGCCGTCGAGCAGATCCAGAAGCTCGTGGACCTGCAACTGCCGGGCGCGCGGCTGAACGCGCTGCCCAA
TCCCCCGCGCCAGATTCCCTACTACGCCCAAAGCACGTACTTCGAAGTGGAATCGACCGATCCGTTCTGG
AAGCAGACCCTCGCCGGCTCGGCGATGGCGCTGCGCATCGTCGGCGATTTCCCCGATCTTCGCTTCGAAG
CCTGGGGGCTGAGAGACGGCAAGGTGGCGTGA