SecReT6
Protein ID: 556574114
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5242
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2141034..2141303 [+]
ProductPAAR motif family protein
NotePAAR
UniProt IDU5V5W8
KEGG IDbpk:BBK_5242
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 3..21
PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 7..81
PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 72..88
Protein Sequence: 89 a.a.     [Download]
>gi|556574114|ref|YP_008741694.1| PAAR motif family protein [Burkholderia pseudomallei NCTC 13179]
MTIPAARVGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFINRLPAAFVGG
VTSCGAPIVSGSPDVMIGS
 
Nucleotide Sequence: 270 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2141034-2141303 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGACAATCCCGGCAGCAAGAGTGGGAGATGCGATCGGACATGGCGGCGTTCTCGTCACCGGCTCAGGTG
ACGTATTCATGAACGGTATTCCCGCGGGATTCGTCGCCGGCAGCGTCGCCGTGTGCGCGCTGCATGCGTC
CGCGCAGGCGGTGGTCGCCGCATCGGGAACGGTATTCATCAATCGCCTCCCGGCTGCGTTCGTCGGTGGC
GTGACGTCGTGCGGCGCGCCGATCGTTTCAGGCTCGCCCGACGTCATGATCGGCTCATAA