SecReT6
Protein ID: 556574140
SecReT6 ID864
T6SS typei3
Gene symbol-
Locus tagBBK_4862
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]1680463..1681035 [-]
Productlysozyme family protein
NoteTssE
UniProt IDU5V6R3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 2.10E-22, Aligned region: 54..168
Protein Sequence: 190 a.a.     [Download]
>gi|556574140|ref|YP_008741314.1| lysozyme family protein [Burkholderia pseudomallei NCTC 13179]
MNDDVRAAGGVRAAHDRLQPALLDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNT
RNGEDGFVDWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAP
GGAAGERRHNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 573 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c1681035-1680463 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAATGACGACGTGCGAGCCGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCG
ACCGGCTGCAGCCGGCGCTGCTCGACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGA
CGCGCAGGCGATCGGCGGCGAGCGCCTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACG
CGCAACGGCGAGGACGGCTTCGTCGACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACG
GGATGCGGCCGCTCGTCGGCAAGCCGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGA
TGCGATCGTGCGTTTCGAGCCGCGTATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCG
GGCGGCGCGGCGGGCGAGCGCCGGCACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTC
CGCATCCGGTCGAGTTCGTGCTGCGCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGC
GGCGGGAGGCTGA