SecReT6
Protein ID: 556574190
SecReT6 ID867
T6SS typei3
Gene symbol-
Locus tagBBK_5728
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2749174..2750763 [+]
ProductAAA domain family protein
NoteTssH
UniProt IDU5V6W4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.50E-34, Aligned region: 170..336
ClpB_D2-small [PF10431], Evalue: 4.30E-08, Aligned region: 342..415
ClpB_D2-small [PF10431], Evalue: 4.30E-08, Aligned region: 423..440
AAA_5 [PF07728], Evalue: 9.30E-08, Aligned region: 175..275
AAA [PF00004], Evalue: 5.20E-06, Aligned region: 175..260
Sigma54_activat [PF00158], Evalue: 0.00018, Aligned region: 174..284
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 174..225
Zeta_toxin [PF06414], Evalue: 0.00031, Aligned region: 444..473
Torsin [PF06309], Evalue: 0.0004, Aligned region: 131..197
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 62..78
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 176..210
AAA_17 [PF13207], Evalue: 0.0025, Aligned region: 433..443
AAA_19 [PF13245], Evalue: 0.0029, Aligned region: 173..196
AAA_19 [PF13245], Evalue: 0.0029, Aligned region: 404..422
AAA_22 [PF13401], Evalue: 0.0034, Aligned region: 173..196
AAA_22 [PF13401], Evalue: 0.0034, Aligned region: 235..260
Protein Sequence: 529 a.a.     [Download]
>gi|556574190|ref|YP_008742173.1| AAA domain family protein [Burkholderia pseudomallei NCTC 13179]
MSQSCAPAELERLQHQAFAIGQTLDWRASDRRMGVRTPGDEAELEGRQASLAQQAATLETVVDAQRDEVR
AWLARLNDATPQAADGDGAAFAARIGANRWVRPWVDEHVVSEVLAEWTGVPVAQLAQDDAQRVVELEAAL
NAGIHGQTGAMRSIAQALQVSHSGLNDPRRPLGVMLLAGPTGTGKSQAAAKLAELLFGGERNLLQFNMNE
FQEAHTVSTLKGAPPGYVGYGKGGRLTEAVRKKPYSVLLLDEFDRAHPDIHEVFYQVFDQGWMEDGEGRR
ISFRNCLILLTSNLGEAEIEAACKADPRISQAKLDKLVGERLQGRFSPALLARIQLVAFRTLDVDALTGI
ATQALDELGERLAQNDLQWRADEGVASWIAHAVSQHPANGRAVRDLLRQHVMPAVARGVLAARAEGRALK
TVRLAANEKLSLVFDEDAWELSGTDAASLGEQAQAVAMAREAEAVAAAVAAREAHGAHGTNEADGGGGAP
HAAKADAHVDSDDERPGGAPHPDETASANAGTTGEPSCV
 
Nucleotide Sequence: 1590 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2749174-2750763 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGAGCCAGAGCTGCGCGCCCGCGGAGCTCGAGCGCTTGCAGCACCAGGCGTTCGCGATCGGCCAGACGC
TCGATTGGCGCGCGAGCGACCGGCGCATGGGCGTGCGCACGCCGGGCGACGAAGCCGAGCTCGAAGGCCG
TCAGGCGAGCCTCGCGCAGCAGGCGGCGACGCTCGAGACGGTCGTGGACGCGCAGCGCGACGAGGTGCGT
GCGTGGCTCGCGCGGCTGAACGACGCCACGCCGCAGGCGGCCGACGGCGACGGCGCTGCGTTCGCCGCGC
GCATCGGCGCGAATCGCTGGGTGCGGCCATGGGTCGACGAACACGTGGTGTCGGAGGTGCTCGCCGAATG
GACGGGGGTGCCCGTCGCGCAGCTCGCGCAGGACGACGCGCAGCGCGTGGTGGAGCTCGAGGCGGCATTG
AACGCGGGCATCCACGGGCAGACGGGCGCGATGCGCTCGATCGCGCAGGCGCTGCAGGTGTCGCACTCGG
GGCTGAACGATCCGCGCCGCCCGCTCGGCGTGATGCTGCTCGCGGGGCCGACGGGCACGGGCAAGAGCCA
GGCGGCCGCGAAGCTCGCCGAGCTGCTGTTCGGCGGCGAGCGCAACCTGCTGCAGTTCAACATGAACGAG
TTCCAGGAAGCGCACACGGTGTCGACGCTCAAGGGCGCGCCGCCGGGGTACGTCGGCTACGGCAAGGGCG
GTCGGCTGACCGAGGCGGTGCGCAAGAAGCCGTACAGCGTGCTGCTGCTGGACGAATTCGATCGCGCGCA
TCCGGACATTCATGAGGTGTTCTATCAAGTCTTCGATCAGGGGTGGATGGAGGACGGCGAAGGCCGCCGG
ATCAGCTTCCGCAACTGCCTGATCCTGCTGACGAGCAATCTGGGGGAGGCGGAGATCGAAGCGGCGTGCA
AGGCCGATCCGCGGATCTCGCAGGCGAAGCTCGACAAGCTGGTGGGCGAGCGGCTGCAGGGGCGTTTCTC
GCCGGCGCTGCTCGCGCGGATTCAGCTCGTGGCGTTCCGCACGCTCGATGTCGACGCGTTGACGGGCATC
GCGACGCAGGCGCTGGACGAGCTGGGCGAGCGCCTGGCGCAGAACGATCTGCAATGGCGCGCGGACGAAG
GCGTGGCGTCGTGGATCGCGCATGCGGTGTCGCAGCATCCGGCGAACGGACGCGCGGTGCGCGACCTGTT
GCGCCAGCACGTGATGCCGGCCGTGGCGCGCGGCGTGCTCGCCGCGCGTGCGGAAGGGCGAGCGCTGAAG
ACGGTGCGGCTCGCGGCGAACGAGAAGCTGTCGCTCGTGTTCGACGAGGACGCGTGGGAGCTGAGCGGCA
CCGATGCGGCGTCGCTCGGCGAGCAGGCGCAGGCGGTGGCGATGGCGCGCGAGGCGGAGGCGGTGGCCGC
TGCCGTGGCGGCACGCGAAGCGCACGGCGCGCACGGCACGAATGAGGCGGATGGAGGCGGCGGCGCGCCG
CACGCGGCGAAAGCCGACGCGCATGTCGATTCGGATGACGAACGTCCAGGCGGCGCGCCTCATCCCGATG
AAACGGCTTCGGCGAACGCCGGCACGACGGGAGAACCGTCATGCGTCTGA