SecReT6
Protein ID: 556574225
SecReT6 ID863
T6SS typei1
Gene symbol-
Locus tagBBK_4113
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]804466..804927 [+]
Productlysozyme family protein
NoteTssE
UniProt IDU5V730
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 6.10E-19, Aligned region: 39..130
Protein Sequence: 153 a.a.     [Download]
>gi|556574225|ref|YP_008740567.1| lysozyme family protein [Burkholderia pseudomallei NCTC 13179]
MADREAARAGEPRTRERRLLERIANREAGGEHDRPPPADVLAHSIIDHLRRILNTRQGHVPIDPAFGVPD
FTNLAGGFAQGSAREIEAQIERVITCYEPRLKAPRVSLAERGPDAATLRFSLDARLVIDAHDVPARFLTT
VTGNGKIDIRTIS
 
Nucleotide Sequence: 462 bp     [Download]
>gi|556571789|ref|NC_022658.1|:804466-804927 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGCTGATCGCGAAGCGGCGCGGGCCGGCGAGCCGCGCACGCGCGAGCGCCGGCTGCTCGAGCGGATCG
CGAACCGGGAAGCGGGCGGCGAGCACGATCGCCCGCCGCCCGCCGACGTGCTCGCGCACTCGATCATCGA
CCACCTGCGCCGCATCCTGAACACGCGGCAGGGCCACGTGCCGATCGATCCCGCCTTCGGCGTGCCGGAT
TTCACGAATCTCGCGGGCGGCTTCGCGCAAGGCTCCGCCCGCGAAATCGAAGCGCAGATCGAGCGCGTGA
TCACCTGCTACGAGCCGCGGCTGAAAGCGCCGCGCGTCTCGCTCGCCGAGCGCGGGCCCGATGCGGCGAC
GCTGCGCTTCAGCCTCGATGCGCGGCTCGTGATCGACGCGCACGACGTGCCGGCGCGCTTTCTGACGACC
GTCACCGGCAACGGAAAGATCGATATCCGAACGATTTCCTGA