SecReT6
Protein ID: 556574337
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5249
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2151152..2151670 [-]
Productlysozyme family protein
NoteTssE
UniProt IDU5VAK7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|556574337|ref|YP_008741701.1| lysozyme family protein [Burkholderia pseudomallei NCTC 13179]
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDARRYPL
VSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|556571789|ref|NC_022658.1|:c2151670-2151152 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGCGGCATCCTGAAGGACGGCATCGGGCCGCCTATCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCACGCGCTCAGCGAATCGCCCGATGCCTATGCGCCGAGCGCCGACGAAATGCGCCGCATCGTGCA
GCGAGACCTGAGCCTGTTGCTGAACACCAGCAATCTGGACGACGAGGTGGACGCCCGCCGCTATCCGCTC
GTGTCGGCATCTGTCGTCAACTATGGCGTGCCGCCTTTGGCGGGCAGCTATCTGCACGACCGGAACCGGG
AAACGATCGAGCGCCTCGTGCGCACCGCGATCGCCCACTTCGAGCCGCGCCTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACCGGGCGCCAGCTACAACAAATTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAATTGAATCGAGTCACGC
TCGAGAAGACGACGCTCAACGGAAATTGA