SecReT6
Protein ID: 556574408
SecReT6 ID865
T6SS typei3
Gene symbol-
Locus tagBBK_5234
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome II [GenBank: NC_022658] [Browse all T6SS(s) in this replicon]
Location [Strand]2127961..2129460 [+]
Producthypothetical protein
NoteTssC
UniProt IDU5V731
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.60E-196, Aligned region: 66..493
Protein Sequence: 499 a.a.     [Download]
>gi|556574408|ref|YP_008741686.1| hypothetical protein BBK_5234 [Burkholderia pseudomallei NCTC 13179]
MAARESQARSADAQLATHSDFNALLSREFKPKTEQAREAVEHAVKTLAEQALANSVTLSDDAYKSIEAII
GEIDRKLSEQINLILHHDDFQQLESAWRGLHHLVTNTETDEKLKIRFMDVSKDDLRRTMKRYKGVAWDQS
PFFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLSSIGKVAAAAHAPFITGASPSVLQMDSWQELA
NPRDLTKIFTQNLEYAPWNSLRNSEDARYIGLAMPRFLARLPYGIRTNPVDEFDFEESTDGSDHRKYVWA
NAAYAMAVNINRSFKHYGWCTLIRGVESGGVVENLPCHTFPTDDGGIDMKCPTEIAISDRREAELAKNGF
IPLIHRKNTDYAAFIGAQSLQKPAEYYDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGSFKERED
MQQWLNEWIMNYVDADPANSSQETKARRPLAAAEVVVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSVKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|556571789|ref|NC_022658.1|:2127961-2129460 Burkholderia pseudomallei NCTC 13179 chromosome 2, complete sequence
ATGGCTGCACGTGAATCTCAGGCGCGCTCCGCCGATGCACAGCTCGCTACGCACTCGGACTTCAATGCCC
TGCTGTCGCGCGAGTTCAAACCGAAGACCGAACAGGCGCGCGAGGCGGTGGAACATGCCGTCAAGACGCT
GGCCGAGCAGGCGCTCGCCAATTCTGTGACGTTGTCGGACGACGCGTACAAGAGCATCGAAGCGATCATC
GGCGAAATCGATCGAAAGCTGTCCGAGCAGATCAACCTGATTCTGCATCACGACGATTTCCAGCAGCTGG
AAAGCGCATGGCGCGGCCTGCATCATCTGGTGACGAATACCGAGACGGACGAGAAGCTCAAGATCCGCTT
CATGGACGTCTCCAAAGACGATCTGCGCCGTACGATGAAGCGATACAAAGGCGTGGCCTGGGACCAGAGC
CCGTTTTTCAAGCAGATCTACGAAGAGGAATACGGTCAGCTCGGCGGCGAGCCGTATGGATGCCTCGTGG
CCGACTACTACTTCGACCACACGCCGCCGGACGTCGATCTGCTTTCGTCGATCGGCAAGGTGGCGGCTGC
CGCGCACGCTCCGTTCATTACCGGCGCATCGCCTTCGGTACTCCAGATGGATTCCTGGCAAGAGCTGGCC
AATCCGCGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATATGCGCCCTGGAATTCGCTGCGCAATT
CCGAAGATGCCCGTTATATCGGTCTTGCGATGCCGCGCTTCCTCGCACGCTTGCCGTATGGAATCAGGAC
GAATCCCGTCGACGAATTCGATTTCGAGGAATCGACGGATGGTTCCGATCATCGCAAGTACGTGTGGGCG
AATGCCGCGTATGCGATGGCGGTCAACATCAATCGCTCGTTCAAGCATTACGGCTGGTGCACGCTGATTC
GCGGTGTGGAAAGCGGCGGCGTCGTCGAGAACCTGCCTTGCCATACGTTCCCGACGGACGACGGCGGCAT
CGACATGAAGTGTCCGACCGAAATCGCGATTTCCGATCGCCGCGAAGCGGAGCTCGCGAAGAACGGCTTC
ATTCCGCTGATCCATCGAAAGAACACCGACTACGCGGCATTCATCGGAGCGCAATCGCTGCAGAAGCCGG
CCGAGTACTACGACCCGGACGCCACCGCGAACGCGAACCTGTCCGCCCGCCTGCCGTACCTGTTCGCGTG
CTCGCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGTTCGTTCAAGGAGCGCGAAGAC
ATGCAGCAGTGGCTCAACGAATGGATCATGAACTATGTCGACGCCGACCCGGCGAACTCGTCGCAGGAGA
CCAAGGCGCGCCGTCCGCTGGCCGCGGCCGAAGTGGTTGTCGAAGACGTGGAAGGCAATCCGGGCTACTA
CCAGGCGAAGTTCTTCCTGCGTCCGCACTTCCAGCTGGAAGGGTTGACCGTGTCGCTGCGCCTCGTCGCG
AAGCTGCCCTCGGTCAAGGAAGCGGCGTAA