SecReT6
Protein ID: 556574594
SecReT6 ID868
T6SS typei4b
Gene symbol-
Locus tagBBK_1801
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]2078860..2080350 [+]
Producthypothetical protein
NoteTssC
UniProt IDU5UQL2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 2.60E-189, Aligned region: 67..491
Protein Sequence: 496 a.a.     [Download]
>gi|556574594|ref|YP_008744380.1| hypothetical protein BBK_1801 [Burkholderia pseudomallei NCTC 13179]
MNQQTAAAQSTGVQAGTESSLLDEIVEKSKVAKSESEHARAKDLIGELVSQVLDGTVVVSDNLSATIDAR
VAELDRLISSQLSAVMHAAEFQRLESTWRGLDYLVKESNTGSTIKIKALHAPKRDLVRDFKNATEFDQSA
LFKKVYEEEFGTFGGSPFGVLVGDYEISRQPEDQYFIEQMSHVAAAAHAPFIASAAPELLGLESFADLGK
PRDLGKVFDTVEYAKWKSFRDSEDSRYVGLTLPRFLGRLPFNPKDGAIAESFNFVEDVDGTDHDKYLWCN
ASWAFAARLTAAFDDFGWCAAIRGVEGGGLVEDLPTHTFKTDDGEIALKCPTEIAITDRREKELSDLGFI
PLVHCKNSDYAAFFAAQSVQKPKKYSTDSANANAVLSAQLQYIFSVSRIAHYLKAMMRDKIGSFASAQNV
ETFLNRWISQYVLLDDDATQEQKAQFPLREASVQVSEIPGKPGAYRSVAFLRPHFQLDELSISLRLVADL
PKPANS
 
Nucleotide Sequence: 1491 bp     [Download]
>gi|556574580|ref|NC_022659.1|:2078860-2080350 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGAACCAGCAAACGGCTGCGGCCCAATCCACCGGCGTTCAAGCCGGCACGGAATCCTCGCTGCTCGACG
AGATCGTCGAGAAGAGCAAGGTCGCGAAATCCGAATCCGAGCATGCGCGCGCGAAGGATCTGATCGGCGA
GCTCGTCAGTCAGGTGCTTGACGGCACGGTGGTGGTGTCGGACAACCTGTCGGCGACCATCGACGCGCGC
GTCGCGGAGCTCGATCGCCTGATCTCGTCGCAGCTCTCGGCCGTGATGCACGCGGCGGAGTTCCAGCGTC
TCGAGAGCACCTGGCGCGGGCTCGATTACCTGGTGAAGGAAAGCAACACCGGCTCGACGATCAAGATCAA
GGCGCTGCACGCGCCGAAGCGCGATCTCGTGCGCGATTTCAAGAACGCGACCGAGTTCGATCAGAGCGCG
CTCTTCAAGAAGGTGTACGAAGAGGAATTCGGCACGTTCGGCGGCTCGCCGTTCGGCGTGCTGGTGGGCG
ACTACGAGATCTCGCGCCAGCCGGAAGACCAGTACTTCATCGAGCAGATGTCGCACGTCGCGGCCGCCGC
GCACGCGCCGTTCATCGCGTCGGCGGCGCCCGAGCTGCTCGGGCTCGAATCGTTCGCGGATCTCGGCAAG
CCGCGCGATCTCGGCAAGGTGTTCGATACCGTTGAATACGCGAAGTGGAAGTCGTTCCGCGATTCCGAGG
ATTCGCGCTACGTCGGCCTCACGCTGCCGCGCTTTCTCGGCCGCCTGCCGTTCAATCCGAAGGATGGCGC
GATCGCGGAGAGCTTCAACTTCGTCGAGGACGTCGACGGCACCGATCACGACAAGTACCTGTGGTGCAAC
GCGTCGTGGGCGTTCGCCGCGCGCCTGACGGCGGCGTTCGACGACTTCGGCTGGTGCGCGGCGATTCGCG
GCGTCGAAGGCGGCGGCCTCGTCGAGGATCTGCCGACCCACACGTTCAAGACCGACGACGGCGAAATCGC
GCTCAAGTGCCCGACCGAGATCGCGATCACCGACCGCCGCGAGAAGGAACTGAGCGATCTCGGTTTCATC
CCGCTCGTGCACTGCAAGAATTCCGATTACGCCGCGTTCTTTGCCGCGCAGTCGGTGCAGAAACCCAAGA
AATACAGCACCGACAGCGCCAACGCGAACGCCGTCCTGTCCGCTCAGCTGCAGTACATCTTCTCGGTATC
GCGCATCGCGCATTACCTGAAGGCGATGATGCGCGACAAGATCGGCAGCTTCGCGTCCGCGCAGAACGTC
GAAACGTTCCTCAATCGCTGGATCTCGCAGTACGTGTTGCTCGACGACGACGCGACGCAGGAACAGAAGG
CGCAGTTCCCGCTGCGCGAGGCCTCCGTACAAGTGTCAGAGATTCCGGGCAAGCCGGGTGCGTATCGTTC
GGTCGCGTTTTTGCGTCCGCACTTCCAGCTCGACGAGTTGTCGATTTCTCTGCGCCTTGTCGCTGATCTG
CCCAAACCGGCAAATTCATAA