SecReT6
Protein ID: 556575436
SecReT6 ID868
T6SS typei4b
Gene symbolclpV
Locus tagBBK_1806
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]2084482..2087151 [+]
Producttype VI secretion ATPase, ClpV1 family
NoteTssH
UniProt IDU5UW40
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.10E-44, Aligned region: 231..328
AAA_2 [PF07724], Evalue: 1.10E-44, Aligned region: 619..787
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 232..345
AAA [PF00004], Evalue: 6.00E-19, Aligned region: 624..719
ClpB_D2-small [PF10431], Evalue: 2.80E-13, Aligned region: 794..868
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 232..252
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 306..362
AAA_5 [PF07728], Evalue: 6.30E-13, Aligned region: 623..744
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 27..74
Clp_N [PF02861], Evalue: 4.30E-12, Aligned region: 114..131
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 56..77
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 209..256
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 276..310
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 469..496
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 614..659
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 690..712
AAA_16 [PF13191], Evalue: 3.20E-10, Aligned region: 742..869
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 232..318
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 351..392
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 620..644
AAA_22 [PF13401], Evalue: 1.20E-06, Aligned region: 685..717
Sigma54_activat [PF00158], Evalue: 4.90E-06, Aligned region: 214..248
Sigma54_activat [PF00158], Evalue: 4.90E-06, Aligned region: 621..741
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 233..302
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 623..658
AAA_17 [PF13207], Evalue: 0.00011, Aligned region: 817..835
Zeta_toxin [PF06414], Evalue: 0.00013, Aligned region: 128..163
Zeta_toxin [PF06414], Evalue: 0.00013, Aligned region: 231..252
Zeta_toxin [PF06414], Evalue: 0.00013, Aligned region: 613..663
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 223..253
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 623..641
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 798..834
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 224..248
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 619..649
AAA_29 [PF13555], Evalue: 0.0002, Aligned region: 719..751
AAA_19 [PF13245], Evalue: 0.00039, Aligned region: 230..258
AAA_19 [PF13245], Evalue: 0.00039, Aligned region: 620..645
AAA_14 [PF13173], Evalue: 0.00081, Aligned region: 233..365
AAA_14 [PF13173], Evalue: 0.00081, Aligned region: 622..704
NACHT [PF05729], Evalue: 0.00082, Aligned region: 232..259
NACHT [PF05729], Evalue: 0.00082, Aligned region: 375..462
NACHT [PF05729], Evalue: 0.00082, Aligned region: 624..643
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 284..336
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 621..662
Arch_ATPase [PF01637], Evalue: 0.0012, Aligned region: 694..717
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 232..255
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 288..327
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 442..493
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 525..551
AAA_25 [PF13481], Evalue: 0.0019, Aligned region: 619..641
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 232..253
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 438..507
SRP54 [PF00448], Evalue: 0.0047, Aligned region: 622..654
MobB [PF03205], Evalue: 0.0078, Aligned region: 233..256
MobB [PF03205], Evalue: 0.0078, Aligned region: 622..655
RNA_helicase [PF00910], Evalue: 0.0093, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.0093, Aligned region: 624..645
Protein Sequence: 889 a.a.     [Download]
>gi|556575436|ref|YP_008744385.1| type VI secretion ATPase, ClpV1 family [Burkholderia pseudomallei NCTC 13179]
MSTPLKTLIAKLNPVCRKATERAASHCFARGHYEVDLEHLFLALLDESTGDVPLVLRASGVDPHALRADL
ERELERLKTGNTRTPVFSVHLSELFEQAWLIASLDSQIGRIRSGHLLLALLTGPDLAQFAQRMSSQFARV
RVDDLKHKFDEIAAGSSEAEPRHADADVAVPDGAAASGDAPRGPSKTPALDTYTTNLTQRAREGKIDPVI
GRDAEIRQAIDILMRRRQNNPIMTGEAGVGKTAVVEGLALRIAADDVPPPLRGVALHVLDMGLLQAGASV
KGEFENRLKSVIDEVKKSAHPIILFIDEAHTIIGAGGQAGQNDAANLLKPALARGELRTIAATTWSEYKK
YFEKDAALARRFQVVKIEEPSEPLAAAMLRGMAALMERHFNVRVLDDAITEAVRLSHRYISGRQLPDKAI
SVLDTACAKVALAHSSTPAAIDDAKKRIERIDAEIAALEREAASGAAHDARLAELREARDADLKALAEDA
ARYEEERALVTEIGALRAELDAARESSADGKPVDVDATRAKLAERVDALRARQGNQPMVPLQVDGHVVAE
IVASWTGIPLGRMVKDEIETVLNLRDLLGARVIGQDHALGAIAQRVRTATANLEDPNKPRGVFMFVGPSG
VGKTETALALADVLYGGERKMITINMSEYQEAHSVSGLKGSPPGYVGYGEGGVLTEAVRRNPYSVVLLDE
VEKAHPDVLEMFFQVFDKGAMDDAEGREIDFRNTLIILTSNVGSSAVMQACLNKAPQELPDAETLAETLR
PQLYKTFKPAFLGRMKVIPYYPISDDVLAEIIELKLERIRRRIEANHKAAFEWDESLVDAVLARCTEVDS
GARNVDHILNGTLLPEIAELVLSRIADGEAIVRIAARAAETGEFEYTVE
 
Nucleotide Sequence: 2670 bp     [Download]
>gi|556574580|ref|NC_022659.1|:2084482-2087151 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGAGCACGCCCCTGAAGACCCTGATCGCGAAACTGAACCCGGTGTGCCGCAAGGCCACCGAGCGCGCCG
CCAGCCACTGCTTCGCGCGCGGTCACTACGAAGTGGATCTCGAGCATCTGTTTCTCGCGCTGCTCGACGA
GTCGACCGGCGACGTGCCGCTCGTGCTGCGCGCGAGCGGCGTCGATCCGCACGCGCTGCGCGCGGATCTC
GAGCGCGAGCTCGAAAGACTGAAAACGGGCAACACGCGCACGCCGGTGTTTTCGGTGCATCTGAGCGAGC
TGTTCGAGCAGGCGTGGCTCATCGCGTCGCTCGATTCGCAGATCGGACGGATCCGCTCGGGGCACCTGCT
GCTCGCGCTGCTGACCGGGCCGGACCTCGCGCAGTTCGCGCAGCGGATGTCGTCGCAGTTCGCGCGCGTG
CGCGTCGATGACCTGAAGCACAAGTTCGACGAGATCGCCGCGGGTTCGAGCGAGGCCGAGCCGCGGCACG
CGGACGCCGACGTCGCGGTGCCCGACGGCGCCGCCGCTTCGGGCGATGCGCCGCGCGGCCCGTCGAAGAC
GCCGGCGCTCGACACGTACACGACGAACCTCACGCAGCGCGCGCGCGAGGGCAAGATCGACCCGGTGATC
GGCCGCGATGCGGAGATCCGCCAGGCGATCGACATCCTGATGCGCCGCCGGCAGAACAATCCGATCATGA
CGGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAAGGGCTCGCGCTGCGCATCGCGGCCGACGACGT
GCCGCCGCCGCTTCGCGGCGTCGCGCTGCACGTGCTGGACATGGGCCTCCTGCAGGCGGGCGCGAGCGTG
AAGGGCGAGTTCGAGAATCGCCTGAAGAGCGTGATCGACGAGGTGAAAAAGAGCGCGCATCCGATCATTC
TCTTCATCGACGAGGCGCACACGATCATCGGCGCGGGCGGGCAGGCGGGCCAGAACGATGCGGCGAACCT
GCTGAAGCCGGCGCTCGCGCGCGGCGAGCTGCGCACGATCGCGGCGACGACGTGGAGCGAGTACAAGAAG
TATTTCGAAAAGGACGCGGCGCTCGCGCGGCGCTTCCAGGTGGTGAAGATCGAGGAGCCGAGCGAGCCGC
TCGCCGCCGCGATGCTGCGCGGGATGGCGGCGCTGATGGAGCGGCACTTCAACGTGCGCGTTCTCGACGA
CGCGATCACCGAGGCGGTGCGGCTGTCGCATCGCTATATCAGCGGCCGCCAGTTGCCGGACAAGGCGATC
AGCGTGCTCGACACCGCCTGCGCGAAGGTCGCGCTCGCGCACAGCTCGACGCCCGCGGCGATCGACGACG
CGAAAAAACGCATCGAGCGGATCGACGCGGAAATCGCGGCACTCGAGCGCGAGGCCGCGAGCGGCGCCGC
GCACGATGCGCGCCTCGCCGAACTGCGCGAGGCCCGCGACGCCGATCTGAAGGCGCTGGCCGAGGACGCC
GCGCGCTACGAGGAGGAGCGCGCGCTCGTGACCGAAATCGGCGCGCTGCGCGCCGAGCTCGATGCCGCGC
GCGAGTCGTCCGCCGACGGCAAGCCCGTCGATGTCGACGCGACGCGCGCGAAGCTTGCCGAGCGCGTCGA
TGCGTTGCGCGCGCGGCAGGGCAACCAGCCGATGGTGCCGTTGCAGGTCGACGGCCACGTCGTCGCGGAG
ATCGTCGCGTCGTGGACGGGCATTCCGCTCGGCAGGATGGTGAAGGACGAGATCGAGACCGTGCTGAACC
TGCGCGATCTGCTCGGCGCGCGCGTGATCGGCCAGGACCATGCGCTCGGCGCGATCGCGCAGCGCGTGCG
CACCGCGACCGCGAACCTCGAGGATCCGAACAAGCCGCGCGGCGTGTTCATGTTCGTCGGGCCGTCGGGC
GTCGGCAAGACCGAGACCGCGCTCGCGCTCGCCGACGTGCTGTACGGCGGCGAGCGCAAGATGATCACGA
TCAACATGAGCGAGTATCAGGAGGCGCACAGCGTGTCGGGCCTGAAGGGCTCGCCGCCCGGCTATGTCGG
CTACGGCGAGGGCGGCGTGCTGACGGAGGCGGTGCGTCGCAATCCGTATTCGGTCGTGTTGCTCGACGAA
GTCGAGAAGGCGCATCCGGACGTGCTCGAGATGTTCTTCCAGGTGTTCGACAAGGGCGCGATGGACGATG
CCGAAGGCCGTGAGATCGACTTTCGCAACACGCTGATCATCCTGACCTCGAACGTCGGCTCGTCGGCGGT
GATGCAGGCGTGCCTGAACAAGGCGCCGCAGGAGCTGCCCGATGCCGAGACGCTTGCCGAGACGCTGCGC
CCGCAGCTCTACAAGACCTTCAAGCCCGCGTTCCTCGGCCGGATGAAGGTGATTCCGTACTATCCGATCT
CCGACGACGTGCTCGCCGAGATCATCGAGCTGAAGCTCGAACGGATTCGCCGCCGGATCGAAGCGAACCA
CAAGGCGGCGTTCGAGTGGGACGAGTCGCTCGTCGACGCCGTGCTCGCGCGCTGCACCGAAGTCGATTCG
GGCGCGCGCAACGTCGATCACATCCTGAACGGCACGCTGCTGCCGGAGATCGCCGAGCTCGTGCTGTCGC
GCATCGCCGATGGCGAGGCGATCGTGCGGATCGCCGCGCGCGCGGCCGAGACGGGCGAATTCGAGTACAC
GGTCGAGTAA