SecReT6
Protein ID: 556575484
SecReT6 ID868
T6SS typei4b
Gene symbol-
Locus tagBBK_1796
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]2074392..2075177 [-]
Producttype IV/VI secretion system , DotU family domain protein
NoteTssL
UniProt IDU5UT74
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.00E-57, Aligned region: 31..232
Protein Sequence: 261 a.a.     [Download]
>gi|556575484|ref|YP_008744375.1| type IV/VI secretion system , DotU family domain protein [Burkholderia pseudomallei NCTC 13179]
MSYAPSLFGGNTPPPAPQTASSTDAGFQARSLVDLLYDGFFMLFLLKNGREPNDASEFGTRIQEFLSEFE
RGAKKLNIAADDVYAAKFAFCAAIDESVLSSPFKIRADWERRPLQLVLFGEQLAGEKFYQYLEECRAQGA
ARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIANMKGKRAPFAPHWPLPDQISHRLKREVPL
WAIGAVFALVGLLAFVGLNTYLKDSTVRALAPYSQVIKVGPESANLTISLP
 
Nucleotide Sequence: 786 bp     [Download]
>gi|556574580|ref|NC_022659.1|:c2075177-2074392 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGAGTTACGCGCCCTCCCTCTTCGGCGGCAACACGCCGCCCCCCGCGCCGCAAACGGCTTCGTCGACCG
ACGCCGGCTTCCAGGCGCGCTCGCTCGTCGATCTGCTGTACGACGGCTTCTTCATGCTGTTCCTGCTGAA
GAACGGCCGCGAGCCGAACGACGCGTCGGAATTCGGCACGCGCATTCAGGAATTCCTGAGCGAGTTCGAA
CGCGGCGCGAAGAAGCTCAACATCGCCGCCGACGACGTCTATGCGGCGAAGTTCGCGTTTTGCGCGGCGA
TCGACGAATCGGTGCTGTCGTCGCCGTTCAAGATCCGCGCGGACTGGGAGCGCCGGCCGTTGCAGCTCGT
GCTGTTCGGCGAGCAACTCGCGGGCGAGAAGTTCTATCAGTACCTCGAAGAATGCCGCGCGCAGGGTGCG
GCGCGACTGCAGTCGCTCGAGGTGTTCCATATGTGCCTGCTGCTCGGCTTCCAGGGCAAGTATCTGCTCG
AAGGGCCGGAAAAGCTCGCGTATCTGACCGCACGGCTTGGCGACGAGATCGCGAACATGAAGGGCAAGCG
CGCACCGTTCGCGCCGCATTGGCCGCTGCCGGACCAGATCTCGCACCGGCTCAAGCGCGAGGTGCCGCTG
TGGGCGATCGGAGCGGTGTTCGCGCTCGTCGGGCTGCTGGCGTTCGTCGGGCTGAATACGTATTTGAAAG
ACAGCACCGTGCGGGCGCTCGCGCCTTATTCGCAAGTCATCAAGGTGGGGCCGGAGTCGGCTAATTTGAC
GATTTCGTTGCCTTGA