SecReT6
Protein ID: 556575684
SecReT6 ID868
T6SS typei4b
Gene symbol-
Locus tagBBK_1798
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]2076629..2077243 [-]
Producttype VI secretion lipofamily protein
NoteTssJ
UniProt IDU5UTN4
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 2.40E-37, Aligned region: 15..176
Protein Sequence: 204 a.a.     [Download]
>gi|556575684|ref|YP_008744377.1| type VI secretion lipofamily protein [Burkholderia pseudomallei NCTC 13179]
MNPHVTRYALPLAACILLGGCAAAVPLLGSAGSAALQMVGVGKPDVPDSQKPPRNLGLTLYAAQNLNAAN
DNRPLALVVRLYALKDPTSFQQAPFDSFTDPTKEKTALGADLLSVREITLIPGQHYNATEKVSREAQAFG
VVALFRDPALQRWKLTFDPAKSEKSGIIIGLHNCAMTVTGGTVIPSQQGMPTQRLDLLSSVNCG
 
Nucleotide Sequence: 615 bp     [Download]
>gi|556574580|ref|NC_022659.1|:c2077243-2076629 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGAATCCGCATGTGACTCGTTACGCGCTGCCGCTCGCCGCCTGCATTCTGCTCGGCGGCTGCGCGGCCG
CCGTGCCGCTCCTCGGTTCGGCGGGCAGCGCCGCGCTGCAGATGGTGGGCGTCGGCAAACCCGACGTGCC
CGATTCGCAGAAGCCGCCGCGCAATCTCGGCCTCACGCTCTATGCGGCACAGAACCTCAACGCCGCGAAC
GACAACCGTCCGCTCGCGCTCGTCGTGCGCCTCTACGCGCTGAAAGATCCGACGTCGTTCCAGCAGGCGC
CGTTCGACAGCTTCACCGATCCGACGAAAGAAAAGACCGCGCTCGGCGCCGATCTGCTGAGCGTACGCGA
AATCACGCTGATTCCGGGGCAGCACTACAACGCGACCGAAAAGGTGTCGCGCGAAGCGCAGGCATTCGGC
GTCGTCGCGCTCTTTCGCGATCCGGCGCTACAACGCTGGAAACTGACTTTCGATCCGGCGAAATCCGAGA
AATCCGGCATAATCATTGGCCTGCACAACTGCGCGATGACCGTGACGGGCGGCACCGTCATCCCTTCGCA
GCAAGGCATGCCGACGCAGCGGCTCGATTTGCTGTCGTCGGTGAACTGCGGGTGA