SecReT6
Protein ID: 556576504
SecReT6 ID868
T6SS typei4b
Gene symbol-
Locus tagBBK_1807
StrainBurkholderia pseudomallei NCTC 13179
Repliconchromosome I [GenBank: NC_022659] [Browse all T6SS(s) in this replicon]
Location [Strand]2087239..2088360 [+]
ProductimpA-related N-terminal family protein
NoteTssA
UniProt IDU5UW29
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.50E-24, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|556576504|ref|YP_008744386.1| LOW QUALITY PROTEIN: impA-related N-terminal family protein [Burkholderia pseudomallei NCTC 13179]
MPINLTELLTPISEASPCGDDLLFSAEFDAIQHARKFDDPSLDQGEWITDIKEADWGFVVEQASALLRER
TKDLRLAVWLTEALAIEDGIGGLTQGYTLLTSLCRQFWDHVHPLPDGDDAEYRLGNVAWLAGRTVELLRA
VPLTDGAANAFSELDWDVAQHVAQAIRRDPEQASEIARGKPSVEQIEASKRMTPVAFYARLLGELKAFQA
ALDALEQELDGRAGDAAPSFRQARDAYETVYRLAERFAKEQGYSADAQPQAVAPPAPSERAEPSFKTPLH
SEEPVPRHAHAPSAPAPIVIAGIQNRAQAVEQLRAVAKYFRGTEPHSPVAYLADKAAEWADMPLHQWLAS
VVKDDGSLAHIRELLGLKPDDNA
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|556574580|ref|NC_022659.1|:2087239-2088360 Burkholderia pseudomallei NCTC 13179 chromosome 1, complete sequence
ATGCCGATCAACCTCACCGAGCTGCTGACGCCGATCAGCGAAGCGTCGCCGTGCGGCGACGATCTCCTGT
TCTCCGCCGAATTCGACGCGATCCAGCACGCGCGCAAGTTCGACGATCCGTCGCTCGACCAGGGCGAATG
GATCACCGATATCAAGGAAGCGGACTGGGGCTTCGTCGTCGAGCAAGCGAGCGCGCTGTTGCGCGAGCGC
ACGAAGGATCTGCGGCTCGCGGTATGGCTGACCGAGGCGCTCGCGATCGAGGACGGCATCGGTGGGCTCA
CGCAGGGCTACACGCTGCTCACGAGCCTCTGCCGGCAGTTCTGGGACCACGTGCATCCGCTGCCCGACGG
CGACGACGCCGAATACCGGCTCGGCAACGTCGCGTGGCTCGCCGGGCGCACGGTCGAGCTGCTGCGCGCG
GTGCCGCTCACCGACGGCGCGGCGAATGCGTTCAGCGAGCTCGACTGGGACGTCGCGCAACACGTCGCGC
AGGCGATCCGGCGCGATCCCGAACAGGCGAGCGAGATCGCGCGCGGCAAGCCGTCCGTCGAGCAGATCGA
GGCGTCGAAGCGGATGACGCCCGTGGCGTTCTACGCGCGGCTGCTCGGCGAGCTGAAAGCGTTCCAGGCG
GCGCTCGACGCGCTCGAGCAGGAACTCGACGGGCGGGCGGGCGACGCGGCGCCGAGCTTCCGGCAGGCGC
GCGACGCGTACGAAACCGTCTACCGGCTCGCCGAACGCTTCGCGAAGGAGCAGGGCTACTCGGCCGACGC
GCAGCCGCAGGCCGTCGCGCCGCCCGCGCCGAGCGAGCGCGCGGAGCCGAGCTTCAAGACGCCGCTTCAT
TCGGAGGAACCCGTGCCGAGACACGCACACGCGCCGTCCGCGCCCGCGCCGATCGTGATCGCCGGCATTC
AGAATCGCGCGCAGGCCGTCGAGCAACTGCGCGCGGTCGCGAAATATTTCCGCGGAACCGAGCCGCACAG
CCCCGTCGCGTATCTCGCCGACAAGGCGGCCGAATGGGCGGACATGCCGCTGCATCAATGGCTCGCGTCG
GTCGTCAAGGACGACGGCTCGCTCGCGCATATCCGCGAGCTGCTCGGCCTGAAGCCGGACGATAACGCGT
GA