SecReT6
Protein ID: 557222681
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09865
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2163444..2165000 [+]
Producthypothetical protein
NoteTssA
UniProt IDU5VDA3
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 9.90E-22, Aligned region: 55..115
Protein Sequence: 518 a.a.     [Download]
>gi|557222681|ref|YP_008762896.1| hypothetical protein PVLB_09865 [Pseudomonas sp. VLB120]
MSYSSKLTARFAALASNAIAPGSFVGEDVRFSSEFEALEAELGKAQSIHASGQVDWLKILEGGETLLREQ
SKDLRVGAWLTWALYQRESYAGLLAGLGMLRQLCEQHWETVHPQKARTRSAAIGWLVPRLEQALDSDIAI
KEQLPLFQQMVEHLAGLEAFLSQQLGTDAPMLLPLCRSLKNQVQRSASNEPPAGSVGAIVNQVKQAATQL
FTPGEPVESEKDAGKALRAQQEQGRQLCVWWQRQKATDLRALRLNRTLLWLPIEAVPERNAENVTALRGV
PVDKLKSYRDRFEQGAYADLLVELENSVAKAPFWFDGQRMVWECCQALNVEAGMREVEMNFASLLQRLPM
LIELKFHDGTPFADPETRAWIASQVSPHLQAVVAQPVVESSERQAPWEEALEAAIPVLRKDGLKKAVQQL
KQQMQGCHGGRERFFWQLSQARLCFTAKKYELAKTQLEALDLQLCQSGLDAWEPDLSLQVLHLLHTCCEL
LPQNHVVRERKDEIYRRLCHLDLEVVLE
 
Nucleotide Sequence: 1557 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2163444-2165000 Pseudomonas sp. VLB120, complete genome
ATGTCCTACTCCTCGAAACTGACTGCGCGTTTTGCAGCGCTCGCCAGTAATGCCATCGCGCCGGGATCTT
TCGTCGGCGAAGATGTGCGTTTTTCTTCCGAGTTCGAAGCCTTGGAAGCTGAACTTGGCAAGGCTCAGTC
AATACATGCCAGCGGCCAGGTCGACTGGCTGAAGATTCTCGAAGGCGGTGAAACGCTGCTGCGAGAGCAG
TCCAAGGATCTGCGCGTCGGTGCCTGGTTGACCTGGGCGCTGTACCAGCGCGAGTCCTACGCGGGGCTGC
TGGCAGGGCTGGGCATGCTGCGCCAGTTGTGCGAGCAGCACTGGGAGACAGTTCATCCGCAAAAGGCCCG
TACGCGCTCGGCGGCGATCGGCTGGCTGGTTCCGCGCCTGGAGCAGGCGTTGGACAGCGATATCGCGATC
AAGGAGCAACTGCCACTGTTCCAGCAGATGGTCGAGCACCTCGCTGGGCTCGAGGCGTTTCTCTCGCAGC
AACTGGGCACCGATGCACCGATGCTGCTGCCGCTTTGCCGTTCGCTCAAGAACCAGGTGCAACGTTCGGC
CAGCAACGAGCCGCCAGCGGGGAGTGTCGGGGCGATCGTCAACCAGGTCAAGCAGGCGGCCACGCAGCTG
TTCACTCCTGGCGAACCGGTGGAGAGTGAAAAGGATGCCGGCAAGGCCCTGCGTGCCCAGCAGGAGCAGG
GGCGCCAGCTGTGCGTGTGGTGGCAGCGACAGAAAGCCACCGACCTGCGCGCGCTGCGCCTTAACCGCAC
ACTGCTGTGGTTGCCCATCGAAGCCGTTCCCGAACGCAACGCCGAGAATGTCACCGCGCTAAGGGGGGTG
CCGGTCGACAAGCTCAAGAGCTACCGCGACCGCTTCGAGCAAGGCGCCTATGCCGACCTGCTGGTCGAAC
TGGAGAACAGCGTGGCCAAGGCGCCGTTCTGGTTCGACGGACAGCGCATGGTCTGGGAGTGCTGCCAGGC
CCTGAACGTCGAGGCCGGCATGCGTGAAGTGGAAATGAACTTCGCCTCGCTGCTGCAGCGCCTGCCCATG
CTGATCGAGCTCAAGTTTCACGATGGCACACCGTTCGCCGACCCCGAGACCCGCGCCTGGATTGCCTCCC
AGGTCTCGCCCCACCTGCAGGCAGTCGTCGCTCAGCCAGTGGTCGAATCCAGCGAGCGCCAGGCGCCCTG
GGAAGAGGCCCTGGAAGCGGCGATCCCGGTACTGCGCAAGGATGGCCTGAAGAAGGCGGTGCAGCAGCTC
AAGCAGCAGATGCAAGGGTGCCACGGCGGGCGAGAGCGTTTCTTCTGGCAACTCAGCCAAGCCCGGCTGT
GCTTCACGGCAAAAAAGTACGAGCTGGCCAAGACCCAACTGGAAGCCCTCGATCTGCAGCTGTGCCAATC
CGGCCTGGATGCCTGGGAGCCAGACCTGTCGCTGCAGGTGCTGCATCTGTTGCACACCTGCTGTGAATTG
TTGCCGCAGAACCATGTGGTTCGCGAGCGCAAGGACGAGATCTATCGCCGTCTGTGCCACCTCGATCTCG
AAGTCGTACTCGAATAG