SecReT6
Protein ID: 557222682
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09870
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2165034..2165534 [+]
Producthypothetical protein
NoteTssB
UniProt IDU5VGD0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 6.60E-54, Aligned region: 5..159
Protein Sequence: 166 a.a.     [Download]
>gi|557222682|ref|YP_008762897.1| hypothetical protein PVLB_09870 [Pseudomonas sp. VLB120]
MAKEGSVAPKERINVTFKPATGGAQEEIELPLKLLAIGDYTLRADDRKIEDRKPISIDKMNFDEVLAKQE
LSMTLAVPNRLQEGAESDELAVSLRINSMKDFNPASLVEQVPELKKLMELREALVALKGPLGNAPAFRKA
IEGVLADDASRERVLGELGINATPDA
 
Nucleotide Sequence: 501 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2165034-2165534 Pseudomonas sp. VLB120, complete genome
ATGGCCAAAGAAGGCTCGGTAGCCCCCAAGGAACGTATCAACGTCACCTTCAAACCCGCCACTGGCGGCG
CTCAGGAAGAGATCGAACTGCCGCTGAAACTGCTGGCGATCGGTGACTACACGCTGCGTGCCGATGATCG
CAAGATCGAAGACCGCAAACCGATCAGCATCGACAAGATGAACTTCGACGAAGTGCTGGCCAAGCAGGAA
CTGAGCATGACCCTGGCCGTGCCCAATCGCCTGCAGGAAGGCGCCGAAAGCGACGAGCTTGCCGTCAGCC
TGCGCATCAATTCGATGAAGGACTTCAACCCGGCCAGCCTGGTCGAGCAGGTGCCTGAGTTGAAGAAGCT
GATGGAGCTGCGTGAGGCCCTGGTCGCGCTGAAAGGCCCGCTGGGTAACGCTCCAGCGTTCCGCAAGGCC
ATCGAAGGCGTGCTGGCCGATGATGCCTCGCGTGAGCGCGTGCTCGGTGAGCTGGGCATCAATGCAACGC
CGGACGCCTGA