SecReT6
Protein ID: 557222684
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09880
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2167042..2167464 [+]
Producthypothetical protein
NoteTssE
UniProt IDU5VD23
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.70E-20, Aligned region: 25..115
Protein Sequence: 140 a.a.     [Download]
>gi|557222684|ref|YP_008762899.1| hypothetical protein PVLB_09880 [Pseudomonas sp. VLB120]
MTSGYGSLFERLSGEAGKRANWRREDAAMASVAAHLAKMLSTRAGSVQTLADYGLPDLNDMRLSLHDALS
QARQAIEHFIEAYEPRLSDVRVISRPRDHDQLKLAFSIEGQLEVNGIKRQVSFAARLDGSGQVSVGQGDW
 
Nucleotide Sequence: 423 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2167042-2167464 Pseudomonas sp. VLB120, complete genome
ATGACGAGCGGATACGGAAGCCTGTTCGAACGTTTGAGCGGCGAAGCCGGCAAGCGTGCCAACTGGCGGC
GTGAAGATGCTGCCATGGCGTCCGTCGCCGCTCATCTGGCGAAGATGCTCAGCACCCGGGCCGGCAGCGT
GCAGACGCTTGCCGACTACGGGTTGCCCGATCTCAACGACATGCGCCTGAGCCTGCACGACGCGCTCAGT
CAGGCCCGCCAGGCCATCGAGCATTTCATCGAGGCCTACGAGCCGCGCTTGTCGGATGTCAGGGTGATTT
CAAGACCGCGTGATCACGATCAGCTCAAGCTCGCTTTCAGTATCGAAGGCCAGCTTGAGGTGAACGGTAT
CAAGCGCCAGGTCAGTTTTGCCGCGCGCCTGGATGGCAGCGGGCAAGTCAGCGTAGGTCAGGGAGACTGG
TGA