SecReT6
Protein ID: 557222685
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09885
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2167593..2169380 [+]
Producthypothetical protein
NoteTssF
UniProt IDU5VCN0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.20E-184, Aligned region: 3..595
Protein Sequence: 595 a.a.     [Download]
>gi|557222685|ref|YP_008762900.1| hypothetical protein PVLB_09885 [Pseudomonas sp. VLB120]
MSFNHYYQSELTALRQLGRRFAERSPALAPYLGQAGRDPDVERLLEGFAFLTGRLRQKLDDELPELTHSL
MLLLWPNYMRPLPAFSILQFDPLRQAGPALLVERDTPVEGRPIDGVSCRFRTCYPTEVLPLKLSALNYSL
NGQGALLSLRLDMNCDGHVGDVKLSRLRLHLAGERYISQMLYLSLLRGLAGIELIALCSNGKPLLNDAGD
PLVLKARDAKVHPVGFAEEEALIPYPLNTFRGYRFLQEYFAFQDKFLFVDVTGLDVLQRLPEETLKQVHG
VEVRFDIRKAEAQRLRPTLDNVKLYCTPIVNLFKHDALPIRLDGKQDEYLLLPAELDPEHCGVFSVDGVT
GWSPGGLGYQEYVPFESFEHDPSFDVPHSRSHYSLRQRSSLLHDGLDTYLSFGVHGGEFHETLSIELTCT
NQNLPRRLKLGDICMLSEQTPEFLTFRNITAVTSSYAPPLNRDFLWKLISNMSLNYLSLADVDALKVILE
TYDLPRYYDQHAEKVSRRLLGGLKSIRHQHVDRLHRGLPLRGLRTELTIDPEGYIGEGDLFVFASVLNEF
FALYASLNSYHELRVKSTQGEVYQWTPRMGLQPLL
 
Nucleotide Sequence: 1788 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2167593-2169380 Pseudomonas sp. VLB120, complete genome
ATGTCCTTCAATCATTACTACCAAAGCGAGCTGACGGCCCTGCGCCAGCTAGGTCGCCGTTTCGCCGAGC
GCAGCCCGGCGTTGGCGCCGTACCTGGGCCAGGCCGGACGCGACCCCGATGTCGAGCGGCTGCTCGAAGG
CTTTGCCTTTCTCACGGGTCGTTTACGCCAGAAGCTCGACGACGAGCTGCCTGAGCTCACTCACTCACTG
ATGTTGCTGCTGTGGCCCAACTACATGCGTCCGTTGCCAGCCTTCAGCATCCTGCAGTTCGACCCGCTGC
GCCAGGCCGGTCCGGCACTGCTGGTCGAGCGCGACACGCCAGTGGAAGGTCGGCCTATCGATGGGGTCAG
CTGCCGCTTTCGCACCTGTTACCCCACCGAGGTCCTGCCGCTGAAACTGAGCGCGCTCAATTACTCGCTC
AATGGTCAGGGCGCGCTGCTCAGCCTGCGCCTGGACATGAACTGCGATGGCCATGTCGGCGACGTCAAGC
TCAGCCGCCTGCGCCTGCACCTGGCCGGAGAGCGCTACATCAGCCAGATGCTCTACTTGAGCCTGTTGCG
CGGACTGGCTGGCATCGAGCTCATAGCGCTGTGCAGCAATGGCAAACCGTTGCTCAACGACGCTGGCGAT
CCGCTGGTCCTCAAGGCGCGGGATGCCAAGGTTCATCCGGTAGGGTTCGCCGAGGAAGAGGCGCTGATTC
CTTACCCGTTGAACACGTTTCGTGGCTATCGCTTCTTGCAGGAGTACTTCGCCTTCCAGGACAAGTTCCT
GTTCGTCGATGTCACTGGCCTGGACGTTCTGCAGCGGCTGCCCGAGGAAACCCTCAAGCAGGTGCACGGC
GTGGAGGTGCGTTTCGATATCCGCAAAGCCGAAGCCCAGCGCCTGCGCCCGACCCTGGACAATGTGAAAC
TGTACTGCACGCCAATCGTCAACCTGTTCAAGCACGACGCCTTGCCGATCCGCCTGGACGGCAAGCAGGA
CGAATACCTGCTGTTGCCTGCCGAGCTCGACCCCGAGCACTGCGGGGTATTCTCGGTCGATGGTGTCACC
GGCTGGAGCCCCGGAGGGCTGGGCTACCAAGAATACGTGCCCTTCGAGTCCTTCGAGCACGACCCCAGCT
TCGATGTGCCGCACAGCCGATCGCACTACAGCCTGCGCCAACGCTCTTCGCTGCTGCACGATGGCCTCGA
TACCTACCTGAGCTTCGGTGTGCATGGCGGCGAGTTCCACGAGACCTTGTCGATCGAGCTGACGTGCACC
AATCAGAACCTGCCGCGGCGGCTCAAACTCGGTGACATCTGCATGCTGAGCGAGCAGACCCCCGAGTTCC
TGACCTTCCGCAACATCACTGCGGTCACCTCCAGTTATGCACCGCCGCTCAATCGCGATTTTCTTTGGAA
GCTGATCAGCAACATGTCGCTGAACTACCTGTCGCTGGCCGATGTGGACGCGCTGAAGGTCATCCTCGAA
ACCTATGACCTGCCGCGCTACTACGACCAGCACGCGGAGAAGGTCAGCCGACGCCTGCTCGGTGGGCTCA
AGTCGATCCGCCACCAGCATGTCGACCGCTTGCACCGTGGCCTGCCGCTACGCGGCCTGCGCACCGAACT
GACGATCGATCCCGAGGGTTACATCGGTGAAGGCGACCTGTTCGTCTTCGCCTCGGTGCTCAACGAGTTC
TTCGCACTCTACGCCAGCCTCAACTCGTACCACGAGCTGCGGGTGAAAAGCACACAAGGGGAGGTGTACC
AATGGACACCACGTATGGGCCTGCAGCCCCTGCTTTGA