SecReT6
Protein ID: 557222686
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09890
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2169344..2170351 [+]
Producthypothetical protein
NoteTssG
UniProt IDU5VDA7
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.60E-84, Aligned region: 19..321
Protein Sequence: 335 a.a.     [Download]
>gi|557222686|ref|YP_008762901.1| hypothetical protein PVLB_09890 [Pseudomonas sp. VLB120]
MDTTYGPAAPALSRLSRSIREYSLFQAVLLVTEQLREHYPYLEDDELYDLLEFEANPSLGFPRSDVDRVE
FFREHGQLRARLRFNLVSLIGSSSPLPAFYGEQALGDSEDGNPTRQFLDLFHHRLQRLLLPIWQKYRYRA
SFKSGALDGFSSHLFALIGLGGEEIRRAKELNWKRLLPYLGVLSLRAHSAALIEAVLRYYFKHADLVIEQ
CLERRVEILEEQCNRLGLANSLLGEDAVLGERVRDRSGKFRIHITQLDWQRFHEFLPIGLGYQPLCALVR
FTLRDPLDYDIRLELRREEIRELRIGEQNVCHLGWTSWLGRERADGVVTLGSKIH
 
Nucleotide Sequence: 1008 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2169344-2170351 Pseudomonas sp. VLB120, complete genome
ATGGACACCACGTATGGGCCTGCAGCCCCTGCTTTGAGCCGGCTGAGCCGGAGCATCCGTGAATACTCGC
TGTTCCAGGCGGTTCTGCTGGTCACCGAGCAGTTGCGCGAGCATTACCCGTACCTGGAGGACGACGAGCT
GTATGACCTGCTCGAGTTCGAGGCCAACCCGAGCCTGGGCTTTCCGCGCAGCGATGTCGACCGCGTCGAG
TTCTTCCGCGAGCACGGCCAGTTGCGTGCGCGTCTTCGATTCAACCTGGTGAGCCTGATCGGTTCCAGCT
CGCCGCTGCCCGCGTTCTATGGCGAACAGGCGTTGGGTGACAGTGAAGATGGCAACCCCACGCGCCAGTT
TCTCGACCTGTTCCACCACCGGCTGCAACGCTTGCTCCTGCCGATCTGGCAAAAGTACCGCTACCGCGCC
AGCTTCAAGAGCGGGGCGCTGGATGGCTTCTCATCGCACCTGTTCGCCTTGATCGGCCTGGGCGGTGAGG
AGATCCGCAGGGCAAAGGAACTGAACTGGAAGCGCCTACTGCCGTACCTGGGCGTGCTGAGCCTGCGTGC
GCATTCGGCCGCCCTGATCGAGGCGGTGCTGCGCTATTACTTCAAGCACGCCGACCTGGTCATCGAGCAA
TGCCTGGAACGACGCGTGGAGATTCTCGAGGAACAGTGCAACCGCCTTGGCCTGGCGAACAGCCTGCTCG
GTGAAGACGCGGTACTGGGCGAGCGGGTGCGCGATCGCAGTGGCAAGTTCCGTATTCACATCACCCAGTT
GGACTGGCAGCGCTTTCACGAATTCCTGCCCATCGGCCTCGGCTATCAGCCGCTGTGTGCGTTGGTGCGT
TTCACGCTGCGCGACCCCCTTGATTACGACATCCGCCTGGAGCTGCGCCGCGAGGAAATTCGCGAGCTAC
GCATTGGCGAGCAGAACGTCTGCCACTTGGGCTGGACCAGCTGGTTGGGGCGCGAGCGCGCCGATGGCGT
GGTGACTTTGGGAAGCAAAATTCATTAA