SecReT6
Protein ID: 557222687
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09895
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2170364..2172970 [+]
ProductClpA/B-type protease
NoteTssH
UniProt IDU5VGD5
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.70E-44, Aligned region: 206..252
AAA_2 [PF07724], Evalue: 7.70E-44, Aligned region: 602..767
AAA [PF00004], Evalue: 1.70E-19, Aligned region: 208..339
AAA [PF00004], Evalue: 1.70E-19, Aligned region: 607..732
AAA_5 [PF07728], Evalue: 4.40E-13, Aligned region: 208..231
AAA_5 [PF07728], Evalue: 4.40E-13, Aligned region: 283..338
AAA_5 [PF07728], Evalue: 4.40E-13, Aligned region: 606..725
ClpB_D2-small [PF10431], Evalue: 1.90E-10, Aligned region: 443..458
ClpB_D2-small [PF10431], Evalue: 1.90E-10, Aligned region: 509..524
ClpB_D2-small [PF10431], Evalue: 1.90E-10, Aligned region: 778..846
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 10..86
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 186..229
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 252..286
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 334..392
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 577..643
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 671..700
AAA_16 [PF13191], Evalue: 6.00E-09, Aligned region: 752..798
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 207..294
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 481..522
AAA_22 [PF13401], Evalue: 6.00E-09, Aligned region: 605..720
AAA_17 [PF13207], Evalue: 6.70E-06, Aligned region: 208..262
AAA_17 [PF13207], Evalue: 6.70E-06, Aligned region: 605..641
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 205..230
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 353..383
AAA_19 [PF13245], Evalue: 1.90E-05, Aligned region: 604..628
Sigma54_activat [PF00158], Evalue: 7.50E-05, Aligned region: 203..224
Sigma54_activat [PF00158], Evalue: 7.50E-05, Aligned region: 606..724
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 202..229
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 606..624
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 201..229
AAA_29 [PF13555], Evalue: 0.0004, Aligned region: 604..631
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 208..228
AAA_18 [PF13238], Evalue: 0.00051, Aligned region: 607..638
NACHT [PF05729], Evalue: 0.00054, Aligned region: 208..235
NACHT [PF05729], Evalue: 0.00054, Aligned region: 466..500
NACHT [PF05729], Evalue: 0.00054, Aligned region: 606..631
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 208..241
SRP54 [PF00448], Evalue: 0.0015, Aligned region: 605..627
AAA_25 [PF13481], Evalue: 0.0021, Aligned region: 208..232
AAA_25 [PF13481], Evalue: 0.0021, Aligned region: 264..303
AAA_25 [PF13481], Evalue: 0.0021, Aligned region: 508..586
AAA_25 [PF13481], Evalue: 0.0021, Aligned region: 603..635
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 174..226
DUF258 [PF03193], Evalue: 0.0024, Aligned region: 605..619
Clp_N [PF02861], Evalue: 0.004, Aligned region: 38..72
Clp_N [PF02861], Evalue: 0.004, Aligned region: 104..122
Zeta_toxin [PF06414], Evalue: 0.006, Aligned region: 207..227
Zeta_toxin [PF06414], Evalue: 0.006, Aligned region: 447..492
Zeta_toxin [PF06414], Evalue: 0.006, Aligned region: 605..646
MobB [PF03205], Evalue: 0.0062, Aligned region: 208..236
MobB [PF03205], Evalue: 0.0062, Aligned region: 605..628
Protein Sequence: 868 a.a.     [Download]
>gi|557222687|ref|YP_008762902.1| ClpA/B-type protease [Pseudomonas sp. VLB120]
MINVDLQQLVQALDADSRRDLERCAERCVARSGSKILVEDLLLGLFEREGSLLQRALQDAEVDFGEFRAA
LHTAVEHSATRNPVFSPELVQWLQDALLVSNLELSQAQVDQAALILALLRNPLRYAGSRYQKLLGRLDIE
RLKGYALAQQPAAPKAAGQPQGESMLQRFTHNLTEQARAGKLDPVLCRDGSIRQMIDILARRRKNNPIVV
GEAGVGKTAVVEGLAARIVAGQVPPALQGVDLLALDMGLLQAGASVKGEFERRLKGVIDEVKASPRPIIL
FIDEAHTLIGAGGNAGGSDAANLLKPALARGELRTIAATTWAEYKKYFEKDPALARRFQPVQLHEPTVVE
AVTILRGLAQLYEKSHGIYLRDDAVVAAAELSARYLTGRQLPDKAVDVLDTACARVRISLAAPPDSLERL
RAELAEGERQRNAISRDAEAGLQIDQEAFEGLQQRLAEATEQERHLSVRWARQRELAEQVLALRQQVASA
AVAPVAEADEEGTLVETREQLQQRLAETHQALLDAQAQERLVSAEVCPRLVAEVISAWTGVPLTQLAREH
NAKVVSFADDLRARIRGQEQAVHALDRAMRATAAGLNKPDAPVGVFLLVGPSGVGKTETALALADLLYGG
DRFITTINMSEFQEKHTVSRLIGAPPGYVGYGEGGMLTEAVRQKPYSVVLLDEVEKADPDVLNLFYQIFD
KGVANDGEGRQIDFRNTLILMTSNLASDQISALCENGKRPDAEQLESHIRPVLSRHFKPALLARMRVVPY
YPVGGPVLRELIEIKLARLGERLQRRQLAFSYCQPLVDHLAERCSQSESGARLIDHLLDSHVLPKVADRL
LDAMASGEDISRVHATLDPAAGVICEFA
 
Nucleotide Sequence: 2607 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2170364-2172970 Pseudomonas sp. VLB120, complete genome
ATGATCAACGTAGACCTGCAACAACTCGTACAAGCCCTGGATGCCGACAGCCGCCGTGACCTGGAGCGCT
GCGCCGAGCGCTGCGTCGCTCGCAGCGGCAGCAAGATCCTCGTCGAAGACCTGCTGCTCGGCTTGTTCGA
ACGTGAAGGCAGTCTGTTGCAGCGAGCGCTGCAAGACGCCGAGGTCGATTTCGGCGAATTCCGCGCCGCG
CTGCATACGGCGGTCGAGCACAGTGCCACCCGCAACCCCGTGTTCTCCCCGGAACTGGTGCAGTGGTTGC
AGGATGCGCTGCTGGTGTCCAACCTTGAACTGAGCCAGGCCCAGGTCGACCAGGCTGCCTTGATCCTGGC
ACTGTTGCGCAACCCGCTGCGCTATGCCGGCAGCCGTTACCAGAAGCTCCTAGGCCGCCTGGATATCGAA
CGCCTAAAGGGCTATGCGCTGGCCCAGCAGCCCGCTGCGCCCAAGGCCGCTGGCCAGCCTCAGGGCGAGT
CGATGCTGCAGCGTTTCACCCACAACCTTACCGAGCAGGCCCGTGCCGGCAAGCTCGACCCGGTGCTGTG
CCGCGACGGTTCGATCCGCCAGATGATCGATATCCTCGCTCGTCGACGCAAGAACAACCCCATCGTGGTG
GGCGAGGCCGGTGTCGGCAAGACCGCCGTGGTCGAAGGGCTGGCGGCGCGTATCGTCGCAGGCCAGGTGC
CGCCTGCCTTGCAGGGCGTCGACCTACTGGCGCTGGACATGGGCCTGTTGCAGGCTGGCGCCAGCGTCAA
AGGCGAGTTCGAGCGGCGCCTCAAGGGCGTGATCGACGAGGTCAAGGCCTCGCCCCGGCCAATCATCCTG
TTCATCGACGAAGCACACACCCTGATCGGTGCCGGTGGCAACGCGGGTGGCTCCGATGCCGCCAACCTGC
TCAAGCCCGCGTTGGCACGCGGCGAACTGCGCACCATCGCCGCCACCACCTGGGCCGAATACAAGAAATA
CTTCGAGAAGGACCCGGCACTGGCCCGTCGCTTCCAGCCGGTGCAACTGCATGAGCCGACCGTGGTTGAA
GCGGTGACCATCCTGCGTGGCCTGGCGCAGTTGTACGAAAAAAGCCACGGCATCTACCTGCGCGACGACG
CCGTGGTGGCCGCTGCCGAGTTGTCGGCGCGCTACCTTACCGGTCGACAACTGCCGGACAAGGCGGTCGA
TGTGCTCGACACCGCTTGTGCCCGCGTGCGCATCAGCCTGGCGGCGCCGCCCGACAGCCTGGAGCGCTTG
CGCGCCGAGCTGGCCGAAGGCGAGCGCCAACGCAATGCCATCAGCCGTGATGCTGAGGCAGGGCTGCAGA
TCGACCAGGAAGCGTTCGAAGGCTTGCAGCAGCGACTGGCCGAAGCGACCGAGCAAGAGCGACACCTGAG
CGTGCGCTGGGCGCGCCAGCGTGAGCTGGCCGAGCAAGTGCTGGCATTGCGTCAGCAAGTTGCCAGCGCT
GCCGTGGCGCCGGTGGCCGAGGCGGACGAGGAGGGCACCCTGGTCGAGACCCGCGAGCAGCTGCAGCAGC
GCCTTGCCGAGACGCACCAGGCCTTGCTCGATGCCCAGGCGCAAGAGCGCCTGGTCAGTGCCGAGGTCTG
TCCACGGCTGGTGGCCGAAGTGATTAGCGCCTGGACGGGCGTGCCGTTGACCCAGCTGGCACGCGAGCAT
AACGCCAAAGTGGTCAGCTTCGCCGACGACCTGCGTGCGCGCATCCGTGGCCAGGAGCAGGCCGTGCATG
CCCTTGACCGTGCCATGCGGGCCACCGCCGCAGGTCTGAACAAGCCCGATGCACCGGTGGGGGTGTTCCT
GCTGGTTGGCCCAAGTGGCGTGGGCAAGACAGAAACGGCGCTGGCCCTGGCCGACCTGCTGTACGGTGGT
GATCGCTTCATCACTACCATCAACATGTCCGAGTTCCAGGAAAAACACACTGTTTCGCGCCTGATCGGTG
CGCCACCTGGATATGTGGGTTATGGCGAAGGCGGCATGTTGACCGAAGCCGTGCGCCAGAAACCATACTC
GGTGGTGTTGCTCGATGAGGTGGAAAAAGCCGACCCCGACGTGCTCAACCTGTTCTATCAGATCTTCGAC
AAAGGCGTGGCCAACGATGGCGAAGGGCGACAGATCGATTTTCGCAACACCCTGATCCTGATGACCTCGA
ATCTGGCCAGCGATCAGATCAGCGCCCTCTGCGAGAACGGCAAGCGCCCGGACGCCGAGCAGCTTGAAAG
CCATATCCGCCCTGTGCTCAGCCGCCACTTCAAGCCGGCCCTGCTGGCGCGCATGCGCGTGGTGCCGTAC
TACCCGGTCGGTGGCCCGGTGCTGCGCGAACTCATCGAGATCAAGCTTGCCCGCCTGGGCGAGCGACTGC
AGCGTCGGCAACTGGCGTTCAGCTATTGCCAGCCGCTGGTCGACCACCTGGCCGAGCGCTGCAGCCAGAG
CGAGAGTGGCGCCCGCCTGATCGACCACCTGCTCGATTCGCACGTGCTGCCAAAAGTGGCTGATCGCCTG
CTCGATGCCATGGCCAGCGGCGAGGACATCAGCCGTGTGCATGCGACCTTGGACCCGGCTGCGGGCGTGA
TCTGCGAGTTCGCCTGA