SecReT6
Protein ID: 557222690
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09910
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2174738..2175919 [+]
Producthypothetical protein
NoteFha
UniProt IDU5VCN4
KEGG IDpsv:PVLB_09910
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 1.80E-11, Aligned region: 30..97
Protein Sequence: 393 a.a.     [Download]
>gi|557222690|ref|YP_008762905.1| hypothetical protein PVLB_09910 [Pseudomonas sp. VLB120]
MELVFELVDRRQHTRTDSPSKSFGRSGGHIGRAKDCHWCIEDEKRHLSSHHAEVTYREGAFYLTDQSSNG
IRLASSGAQLRKGEAYRIEQGAVYQMGDIEVRARLIETDRALDVGLGIPGSDIIPDDAFLALDPLSALDN
EEARLAPMDELAAMTLPDTPAKQRADYAQIDRENIIVPTLVPAPVTEPAPQPAPRERRSEAFWERFGAAL
GVDLAGLDDQAREDLAVQAAGLLRHSIGALQQSLRTRSELKNELRLSLTTPQGASRNPIKAPLEADQALG
ELLKPRRPGQLSAEQAVAQAFRDLQAHQVALLGASRSALRSTLEHFAPSQLALQFERLGRKPWFGSRWKQ
YVRYHEALSADADWSERLLAKDFAQTYEEQVRLIASLHHDPRG
 
Nucleotide Sequence: 1182 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2174738-2175919 Pseudomonas sp. VLB120, complete genome
ATGGAACTGGTTTTCGAGCTGGTGGACAGACGCCAGCACACCCGCACCGACTCGCCCAGCAAGTCGTTTG
GCCGCAGTGGCGGCCACATTGGACGCGCCAAGGACTGCCACTGGTGCATCGAGGACGAAAAGCGCCACTT
GTCCAGCCACCATGCCGAGGTCACCTATCGCGAGGGCGCCTTCTACCTCACCGACCAGAGCAGCAATGGC
ATTCGCCTGGCCAGCAGCGGTGCGCAACTGCGCAAGGGCGAGGCCTACCGTATCGAGCAGGGGGCGGTGT
ACCAGATGGGCGACATCGAGGTGCGCGCCCGCTTGATCGAAACGGATCGTGCCTTGGATGTAGGGCTCGG
CATACCGGGATCGGACATCATCCCCGATGATGCCTTCCTCGCGCTTGACCCGCTGTCCGCCCTGGACAAC
GAAGAGGCGCGCCTTGCACCGATGGATGAACTGGCCGCCATGACCTTGCCCGACACCCCGGCCAAGCAGC
GTGCCGACTACGCCCAGATCGACCGCGAAAACATCATCGTGCCGACGTTGGTGCCAGCCCCGGTTACCGA
GCCTGCCCCGCAACCGGCCCCGCGCGAACGGCGAAGTGAAGCATTCTGGGAGCGCTTCGGCGCAGCGCTG
GGCGTCGACCTCGCCGGTCTCGACGATCAAGCTCGCGAAGACCTCGCGGTGCAGGCAGCCGGTTTGCTGC
GCCACAGTATCGGTGCCTTGCAGCAAAGCTTGCGCACCCGTAGCGAGCTCAAGAACGAGTTGCGCCTGTC
GCTCACCACCCCGCAAGGCGCCAGCCGGAACCCGATCAAGGCGCCGTTGGAAGCCGACCAGGCCCTGGGC
GAGTTGCTCAAGCCGCGCCGGCCCGGACAGTTGTCGGCCGAGCAGGCCGTGGCCCAGGCCTTCCGTGACT
TGCAGGCACACCAGGTGGCTTTGCTTGGTGCCAGTCGCAGCGCCTTGCGCAGCACCCTCGAACACTTTGC
CCCCAGTCAGTTGGCGTTGCAGTTCGAACGCCTGGGTCGCAAGCCGTGGTTCGGTAGCCGCTGGAAGCAA
TACGTGCGCTACCACGAAGCACTCAGTGCCGATGCCGACTGGAGCGAGCGCCTGCTGGCCAAGGACTTCG
CCCAAACCTACGAAGAGCAGGTGCGCCTGATCGCTTCCCTTCACCACGATCCGCGAGGATGA