SecReT6
Protein ID: 557222691
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09915
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2175924..2176430 [+]
Producthypothetical protein
NoteTssJ
UniProt IDU5VDB2
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 5.70E-39, Aligned region: 20..154
Protein Sequence: 168 a.a.     [Download]
>gi|557222691|ref|YP_008762906.1| hypothetical protein PVLB_09915 [Pseudomonas sp. VLB120]
MKPITRKCFGAAWALVAASWLTGCAALSPYSHMTKLDLTLTATDALNLDINGRPSPVVVRLFELKHPVAF
ESTDFFTLYQRPKEALDLDMVASEEHELRPGETLSLNLSIDPGSRFVGVLAAYRDLEQAEWRRVQPVRAG
ERTVVNLYLDKTGIHNGVPAVVQAGEQP
 
Nucleotide Sequence: 507 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2175924-2176430 Pseudomonas sp. VLB120, complete genome
ATGAAACCTATCACCCGCAAATGCTTCGGGGCAGCGTGGGCTTTGGTTGCCGCGTCCTGGTTGACCGGCT
GTGCCGCGCTGTCGCCGTATTCGCACATGACCAAGCTCGACCTGACACTGACCGCCACCGACGCGCTCAA
CCTCGACATCAACGGCCGGCCGTCGCCGGTAGTGGTACGTCTGTTCGAGCTCAAGCACCCGGTCGCGTTC
GAAAGCACCGACTTCTTCACGCTCTACCAGCGCCCGAAAGAAGCCCTCGACCTGGACATGGTTGCCAGCG
AAGAGCACGAACTGCGCCCAGGCGAAACCCTGAGCCTGAACCTGAGCATCGACCCAGGCAGCCGCTTCGT
CGGCGTGCTGGCCGCCTATCGCGACCTGGAGCAAGCCGAGTGGCGCCGGGTGCAGCCGGTTCGGGCCGGT
GAGCGGACGGTCGTCAACCTGTACCTGGACAAGACCGGTATTCACAACGGCGTACCAGCGGTAGTCCAAG
CGGGTGAACAGCCATGA