SecReT6
Protein ID: 557222692
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09920
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2176427..2177758 [+]
Producthypothetical protein
NoteTssK
UniProt IDU5VGE1
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.20E-137, Aligned region: 18..442
Protein Sequence: 443 a.a.     [Download]
>gi|557222692|ref|YP_008762907.1| hypothetical protein PVLB_09920 [Pseudomonas sp. VLB120]
MNVHKVVWQEGMLLRPQHFQHNDRYYDSQMKTRTQLLGNCTWGFIDLEIDLQFLTMGKLVISRAAGILPD
GSLFELDGSSEPLALDVPPNTGSTPIFMALPLVTGNHIEARRPEQAEVLTRYTTYELEVSDSNAGDDNST
QINCARPDFRLLLGEQQGDQAYVKLKVCEVLDTSPDGVITLDPDFVPSYIRTQSSVYLQSCLKEVISMLA
LRGDTLAERIRSNGKVGGAEVGDFMMLQLINRTELLLRHYLNLEQVHPEELYRTFLIMLGDLSTFSSDTK
RPRLDARYQHSDQGSSFRKLMESIRQVLSMVLEQHAIELELQQRQYGILVSPLHDPGLLTTASFVLAASA
NCESEELRQRLPLHLKVGPVERIRQLVNLHLPGLKVKPLPVAPRQIPFHANKTYFIVELDAADRAKMDGS
GGFAFHVTSEFSDLELKFWAIRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2176427-2177758 Pseudomonas sp. VLB120, complete genome
ATGAACGTGCACAAGGTAGTCTGGCAGGAAGGCATGCTGCTGCGCCCGCAGCATTTCCAGCACAACGACC
GCTACTACGACAGCCAGATGAAAACCCGCACGCAGCTGCTGGGTAATTGCACCTGGGGTTTCATCGATCT
GGAGATCGACCTGCAGTTCCTGACCATGGGCAAGCTGGTGATCAGTCGTGCCGCAGGCATCCTGCCGGAT
GGCAGTCTGTTCGAGCTCGATGGCAGCAGTGAACCGCTGGCCCTGGACGTGCCGCCAAACACCGGCAGCA
CGCCGATCTTCATGGCCTTGCCGCTGGTCACCGGAAACCACATCGAGGCCCGCCGGCCGGAGCAGGCCGA
GGTATTGACGCGCTATACCACCTACGAGCTGGAGGTCAGCGATTCCAACGCGGGCGATGACAACAGCACC
CAGATCAACTGCGCGCGCCCGGACTTCCGCCTGCTGCTGGGCGAGCAGCAGGGCGACCAGGCGTACGTCA
AGCTCAAGGTGTGCGAAGTGCTCGACACCTCGCCGGACGGGGTCATTACCCTGGATCCGGACTTCGTCCC
GAGCTACATCCGGACCCAATCCTCGGTGTACCTGCAGTCATGCCTGAAGGAAGTGATCAGCATGCTGGCC
TTGCGTGGCGACACCCTGGCCGAGCGCATCCGCTCCAATGGCAAGGTCGGCGGTGCAGAGGTGGGCGACT
TCATGATGCTGCAGCTGATCAACCGTACCGAGTTGCTGCTGCGTCACTACCTGAACCTTGAGCAGGTGCA
CCCGGAAGAGTTGTACCGCACCTTCCTGATCATGCTCGGCGACCTGTCGACCTTCTCCAGCGACACCAAG
CGCCCTCGGCTGGACGCTCGTTACCAGCACAGTGACCAGGGCAGCAGCTTCCGCAAGCTGATGGAGTCGA
TCCGTCAGGTGTTGTCGATGGTGCTCGAGCAACATGCCATCGAGTTGGAGCTGCAACAGCGCCAGTACGG
CATCCTGGTTTCACCCTTGCACGATCCAGGGCTGCTCACCACGGCATCGTTCGTACTGGCCGCCAGCGCC
AACTGCGAATCCGAGGAGCTGCGCCAGCGTCTGCCGCTGCACCTCAAGGTCGGCCCGGTGGAGCGCATTC
GCCAGTTGGTCAACCTTCACTTGCCTGGGCTCAAGGTCAAGCCCTTGCCTGTGGCGCCGAGGCAGATCCC
GTTTCATGCCAACAAAACCTACTTCATCGTCGAACTCGATGCCGCAGATCGCGCCAAGATGGATGGCTCT
GGTGGTTTCGCCTTCCACGTCACCAGTGAGTTCTCCGATCTTGAACTGAAATTCTGGGCCATCAGGAACT
GA