SecReT6
Protein ID: 557222693
SecReT6 ID869
T6SS typei1
Gene symbol-
Locus tagPVLB_09925
StrainPseudomonas sp. VLB120
Repliconchromosome [GenBank: NC_022738] [Browse all T6SS(s) in this replicon]
Location [Strand]2177764..2178630 [+]
Productputative outer membrane protein
NoteTssL
UniProt IDU5VGK0
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.50E-68, Aligned region: 61..265
Protein Sequence: 288 a.a.     [Download]
>gi|557222693|ref|YP_008762908.1| putative outer membrane protein [Pseudomonas sp. VLB120]
MSKDTEHPQDDKTVLYNQDGSAPSGQPLTAHGDAAKVEPLEQRMVYSARLPASGSFSVGLNPLVAAAGEL
ISEVVRLKHSETAEDLNTLKERLSAYIRTFEARIHYEGVESSQVTVARYLICTVVDEAVVTTSWGNESQW
SQMSLLSAFHNETFGGEKFFALLDRMSKNPVKHLAMLELMYLCLSLGFEGKYRVIDRGMSELEGIRDALF
RQIRQLRGDVPRELAPRWEGHDQRHTPVRIVPWWSVALLTMVCLMVLYAGFAWVLGEQRATVLQPFQPLE
QNVAEQKQ
 
Nucleotide Sequence: 867 bp     [Download]
>gi|557220722|ref|NC_022738.1|:2177764-2178630 Pseudomonas sp. VLB120, complete genome
ATGAGCAAGGACACGGAACACCCGCAGGACGACAAGACCGTCCTGTACAACCAGGATGGCTCGGCACCCT
CTGGCCAGCCACTGACGGCCCATGGCGATGCGGCCAAGGTCGAGCCGCTGGAGCAGCGTATGGTCTATTC
GGCGCGGCTCCCTGCCAGCGGCAGCTTCAGCGTCGGTCTCAACCCGTTGGTGGCGGCTGCTGGCGAGTTG
ATTTCGGAAGTGGTGCGGCTCAAGCACAGCGAAACCGCCGAAGACTTGAATACGCTCAAGGAGCGACTGA
GCGCCTACATCCGCACCTTCGAAGCGCGCATCCATTACGAAGGGGTCGAGAGCAGCCAGGTGACGGTGGC
GCGCTACCTGATTTGCACCGTGGTCGATGAAGCCGTGGTCACCACCTCGTGGGGCAACGAAAGTCAGTGG
TCCCAGATGAGCCTGCTCAGTGCGTTTCACAACGAAACCTTCGGCGGCGAGAAGTTCTTCGCCTTGCTCG
ACCGCATGTCGAAGAACCCGGTCAAGCACCTGGCCATGCTGGAGCTGATGTACCTGTGCCTGTCGCTGGG
CTTCGAGGGCAAGTATCGGGTAATCGATCGCGGTATGTCCGAACTCGAAGGCATCCGCGACGCGCTGTTC
CGCCAGATCCGCCAGCTGCGGGGCGACGTGCCGCGCGAGTTGGCGCCACGCTGGGAGGGTCACGACCAGC
GCCACACTCCGGTGCGTATCGTGCCGTGGTGGAGCGTGGCGTTGCTCACGATGGTGTGTCTGATGGTGCT
GTATGCCGGTTTCGCCTGGGTGCTGGGGGAGCAGCGCGCCACCGTCTTGCAACCCTTCCAGCCCCTCGAA
CAGAACGTGGCCGAACAGAAGCAGTGA