SecReT6
Protein ID: 558666121
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0159
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]189209..190294 [-]
ProductSigma-54 dependent transcriptional regulator
NoteSfa3
UniProt IDU6APX1
KEGG IDpaer:PA1R_gp0159
PDB IDNA
Domain hit(s) vs Pfam Sigma54_activat [PF00158], Evalue: 8.40E-69, Aligned region: 22..188
Sigma54_activat [PF00158], Evalue: 8.40E-69, Aligned region: 300..308
Sigma54_activ_2 [PF14532], Evalue: 1.10E-21, Aligned region: 26..192
AAA_5 [PF07728], Evalue: 5.20E-09, Aligned region: 46..162
AAA_5 [PF07728], Evalue: 5.20E-09, Aligned region: 262..302
Mg_chelatase [PF01078], Evalue: 0.00017, Aligned region: 42..65
Mg_chelatase [PF01078], Evalue: 0.00017, Aligned region: 100..163
AAA [PF00004], Evalue: 0.00054, Aligned region: 46..162
HTH_30 [PF13556], Evalue: 0.0014, Aligned region: 315..347
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 243..259
HTH_8 [PF02954], Evalue: 0.002, Aligned region: 308..343
AAA_16 [PF13191], Evalue: 0.0026, Aligned region: 35..83
AAA_16 [PF13191], Evalue: 0.0026, Aligned region: 280..298
AAA_2 [PF07724], Evalue: 0.008, Aligned region: 42..141
Protein Sequence: 361 a.a.     [Download]
>gi|558666121|ref|YP_008802831.1| Sigma-54 dependent transcriptional regulator [Pseudomonas aeruginosa PA1R]
MSVITHPHARELTKSVRATVLVFNDPRSRELLERIERLAPSEANALVIGETGTGKELVARHIHALSGRNG
GPFVAVNCGAFAESLVESELFGHEKGAFTGALQSKAGWFEAANGGTLFLDEIGDLPPSIQVKLLRVLQER
EVVRLGSRRPIPIDVRLVAATNVDLADAVVAGHFREDLFYRLHVATIQLPPLRERRGDILPLAEYFIVEH
CRRLGYTSASLSPEAERKLLGHSWAGNIRELENAIHHALLVCRNRLIQPADLHLIDMRARQEPSGLRRAP
ESAAGSALEAALQALFEENREDLYEHIEETVFRAAYRFCHGNQLQTGRLLGISRNIVRARLEKIGELETS
PRHNVVSLVGK
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c190294-189209 Pseudomonas aeruginosa PA1R, complete genome
ATGTCCGTCATCACCCATCCCCACGCCCGCGAGCTGACCAAATCGGTGCGCGCCACCGTGCTGGTGTTCA
ACGACCCCCGTTCCCGCGAGCTGCTGGAGCGCATCGAGCGCCTGGCGCCCAGCGAGGCCAACGCGCTGGT
CATCGGCGAGACCGGCACCGGCAAGGAGCTGGTGGCGCGCCATATCCATGCCCTCAGCGGACGCAACGGC
GGCCCGTTCGTCGCGGTCAACTGCGGTGCTTTCGCCGAGAGCCTGGTGGAGAGCGAGCTGTTCGGCCACG
AGAAGGGCGCCTTTACCGGTGCGTTGCAGAGCAAGGCCGGCTGGTTCGAGGCGGCCAACGGCGGCACCTT
GTTCCTCGACGAGATCGGCGACCTGCCGCCGAGCATCCAGGTCAAGCTGCTGCGCGTGCTGCAGGAGCGC
GAGGTGGTGCGGCTCGGTTCGCGCCGGCCGATCCCCATCGACGTGCGGCTGGTGGCGGCGACCAACGTCG
ACCTGGCCGACGCGGTGGTCGCCGGGCACTTCCGCGAGGACCTGTTCTACCGCCTGCACGTGGCGACCAT
CCAACTGCCGCCGTTGCGCGAGCGCCGCGGCGATATCCTGCCGCTGGCCGAGTACTTCATCGTCGAGCAC
TGCCGGCGCCTTGGCTACACCAGCGCGAGCCTGAGCCCGGAAGCCGAGCGCAAGCTGCTCGGGCATTCCT
GGGCGGGCAATATCCGCGAGCTGGAGAACGCCATCCACCACGCGCTGCTGGTCTGCCGCAACCGCCTGAT
CCAGCCGGCCGACCTGCACCTCATCGACATGCGTGCGCGCCAGGAGCCGAGCGGCTTGCGCCGCGCCCCC
GAGAGCGCCGCCGGCTCGGCGCTGGAAGCGGCGCTGCAGGCACTGTTCGAGGAAAACCGCGAGGATCTCT
ACGAGCACATCGAGGAAACCGTGTTCCGCGCCGCCTATCGCTTCTGCCACGGCAACCAGTTGCAGACCGG
ACGCCTGCTGGGGATCAGCCGCAACATCGTGCGCGCCCGCCTGGAGAAGATCGGCGAGCTGGAAACCTCG
CCACGACACAACGTGGTCTCGCTGGTGGGCAAGTGA