SecReT6
Protein ID: 558666122
SecReT6 ID870
T6SS typei4a
Gene symbol-
Locus tagPA1R_gp0160
StrainPseudomonas aeruginosa PA1R
Repliconchromosome [GenBank: NC_022806] [Browse all T6SS(s) in this replicon]
Location [Strand]190404..191504 [-]
ProductUncharacterized protein ImpA
NoteTssA
UniProt IDU6AQD9
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 1.30E-22, Aligned region: 249..259
Protein Sequence: 366 a.a.     [Download]
>gi|558666122|ref|YP_008802832.1| Uncharacterized protein ImpA [Pseudomonas aeruginosa PA1R]
MTLPLSGNALSLEVLLEPIDPGQPCGPSLRYDPDYDRLRELRREDDSSLPTGVWQAEAKRADWAAVEQLA
SELLQRRSKDLMLAAWLGEAWLQRGGLGGLQRALVLLAELCERYPEEVHPQAQDGDQSWRVPPIDWLLRR
YAELLHTRLPLMGQGAFAEITLYAWQRLQRQQVASGDSKSAKAALEAAQLQQKKLDEALRAEPLVQWQRK
QASLLACQQQLLRLEQWCDRCLGELAPSCQPLREVIAQWLALLKEFIAMHPQAPLSEEQPPVAEADASEG
DADGEESVPTSAPSGPAGAPTSREDAYRQLLLIADYLARTEPHSPVPYLIKRAVEWGNKPLSELLAELIN
ADSEARRVWSLLGVLP
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|558665962|ref|NC_022806.1|:c191504-190404 Pseudomonas aeruginosa PA1R, complete genome
ATGACCCTGCCTCTTTCCGGCAACGCCCTGTCCCTGGAAGTGCTGCTCGAACCGATCGACCCCGGACAGC
CGTGCGGCCCCAGCCTGCGCTACGACCCGGACTACGACCGCCTGCGCGAGTTGCGCCGGGAGGACGACAG
CAGCCTGCCGACCGGCGTCTGGCAAGCGGAGGCCAAGCGCGCCGACTGGGCCGCGGTGGAGCAGTTGGCC
AGCGAACTGTTGCAGCGGCGCAGCAAGGACCTGATGCTCGCCGCCTGGCTCGGCGAGGCCTGGCTGCAAC
GCGGCGGGCTGGGCGGATTGCAGCGCGCGCTGGTGCTGCTGGCGGAACTCTGCGAGCGCTACCCCGAGGA
GGTGCATCCGCAAGCCCAGGACGGCGACCAGTCGTGGCGGGTGCCGCCCATCGACTGGCTGTTGCGCCGC
TATGCCGAGCTGCTGCACACGCGCCTGCCGCTGATGGGGCAGGGCGCGTTCGCCGAGATCACCCTCTATG
CCTGGCAGAGGTTGCAGCGCCAGCAGGTCGCCAGCGGCGACAGCAAGAGCGCCAAGGCGGCGCTGGAAGC
GGCGCAACTTCAGCAGAAGAAGCTAGACGAAGCGTTGCGCGCGGAGCCCCTGGTGCAATGGCAGCGCAAG
CAGGCCAGCCTGCTCGCCTGCCAGCAGCAACTACTGCGCCTGGAACAGTGGTGCGACCGCTGCCTGGGCG
AACTCGCCCCCAGTTGCCAGCCATTGCGCGAGGTCATCGCGCAATGGCTGGCCTTGCTCAAGGAGTTCAT
CGCCATGCACCCGCAAGCGCCGCTGTCCGAAGAACAGCCCCCGGTCGCGGAGGCGGATGCCAGCGAAGGC
GACGCGGACGGCGAGGAAAGCGTCCCGACGAGCGCGCCGAGCGGGCCGGCTGGCGCGCCGACCAGTCGCG
AGGACGCCTACCGGCAATTGCTGCTGATCGCTGACTACCTGGCGCGCACCGAGCCGCACAGCCCGGTTCC
CTACCTGATCAAGCGCGCGGTGGAGTGGGGCAACAAGCCGCTGAGCGAGTTGCTGGCGGAGCTGATCAAT
GCGGACTCGGAGGCGCGCCGAGTCTGGTCGCTGCTTGGCGTACTGCCCTAA